StarFunc result for job id Q96E29

User Input

>input (417 residues)
MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDNCFLQWGFKT
YRTSSLWNSSQSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLS
PMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLL
RLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADV
AQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKV
YRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVKFPQVFNTRLF
KVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFEKFLKTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96E29	1.000	1.000	1.602E-51	417	1.000	1.000	Q96E29.pdb.gz	MTEF3_HUMAN Transcription termination factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF3 PE=1 SV=2
2	AFDB:Q8R3J4	0.745	0.753	1.306E-40	412	0.765	0.774	Q8R3J4.pdb.gz	MTEF3_MOUSE Transcription termination factor 3, mitochondrial OS=Mus musculus OX=10090 GN=Mterf3 PE=2 SV=1
3	AFDB:Q9VPD5	0.627	0.733	6.648E-20	354	0.278	0.328	Q9VPD5.pdb.gz	MTEF3_DROME Transcription termination factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mTerf3 PE=2 SV=1
4	AFDB:Q9ZT96	0.323	0.254	4.374E-9	541	0.180	0.139	Q9ZT96.pdb.gz	MTEF4_ARATH Transcription termination factor MTERF4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF4 PE=1 SV=1
5	AFDB:Q8BVN4	0.432	0.508	6.160E-9	346	0.185	0.223	Q8BVN4.pdb.gz	MTEF4_MOUSE Transcription termination factor 4, mitochondrial OS=Mus musculus OX=10090 GN=Mterf4 PE=2 SV=1
6	AFDB:F4IHL3	0.508	0.340	1.122E-8	641	0.132	0.086	F4IHL3.pdb.gz	MTEF2_ARATH Transcription termination factor MTERF2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF2 PE=3 SV=1
7	AFDB:Q7Z6M4	0.412	0.448	1.513E-8	381	0.144	0.157	Q7Z6M4.pdb.gz	MTEF4_HUMAN Transcription termination factor 4, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=3
8	AFDB:Q0WRV2	0.513	0.370	3.160E-7	591	0.139	0.098	Q0WRV2.pdb.gz	Q0WRV2_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=MTERF16 PE=1 SV=1
9	PDB:7pd3y	0.425	0.689	5.780E-7	245	0.118	0.200	7pd3y.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
10	AFDB:H7C316	0.279	0.425	3.533E-4	257	0.103	0.167	H7C316.pdb.gz	H7C316_HUMAN Mitochondrial transcription termination factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=1
11	AFDB:O01501	0.149	0.129	2.169E-1	524	0.185	0.147	O01501.pdb.gz	CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans OX=6239 GN=cye-1 PE=1 SV=2
12	PDB:4cj9A	0.270	0.173	3.490E-1	752	0.103	0.057	4cj9A.pdb.gz
13	PDB:5lkhA	0.127	0.070	1.207	948	0.094	0.041	5lkhA.pdb.gz
14	PDB:4v1nM	0.094	0.123	4.360	299	0.077	0.107	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
15	PDB:5hbhB	0.119	0.162	4.360	270	0.067	0.104	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
16	PDB:5o8xA	0.080	0.101	6.408	304	0.043	0.059	5o8xA.pdb.gz	X-ray Structure of Catenated Lytic Transglycosylase SltB1.
17	PDB:5jwfA	0.074	0.053	6.689	700	0.086	0.051	5jwfA.pdb.gz
18	PDB:7yzpC	0.056	0.053	6.689	448	0.058	0.054	7yzpC.pdb.gz	Structural mechanism of endonucleolytic processing of blocked DNA ends and hairpins by Mre11-Rad50.
19	PDB:5iy7M	0.110	0.131	8.284	310	0.058	0.077	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
20	PDB:7a5fR3	0.106	0.232	9.025	140	0.046	0.136	7a5fR3.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5RIK9	0.0	720	361	0.847	0.978	E5RIK9_HUMAN Mitochondrial transcription termination factor 3 OS=Homo sapiens OX=9606 GN=MTERF3 PE=1 SV=1
2	Q8R3J4	0.0	642	412	0.765	0.774	MTEF3_MOUSE Transcription termination factor 3, mitochondrial OS=Mus musculus OX=10090 GN=Mterf3 PE=2 SV=1
3	Q96E29	0.0	852	417	1.000	1.000	MTEF3_HUMAN Transcription termination factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF3 PE=1 SV=2
4	Q9VPD5	7.05e-65	213	354	0.266	0.314	MTEF3_DROME Transcription termination factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mTerf3 PE=2 SV=1
5	Q9FM80	9.60e-11	65.9	496	0.165	0.139	MTEF9_ARATH Transcription termination factor MTERF9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF9 PE=2 SV=1
6	F4JVI3	1.67e-09	62.0	493	0.132	0.112	MTEF5_ARATH Transcription termination factor MTERF5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF5 PE=1 SV=1
7	F4JSY9	8.31e-09	59.3	378	0.163	0.180	F4JSY9_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=PDE191 PE=1 SV=1
8	Q9SZL6	8.94e-09	58.9	333	0.163	0.204	MTEF6_ARATH Transcription termination factor MTERF6, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTERF6 PE=2 SV=1
9	Q8BVN4	9.42e-09	58.9	346	0.161	0.194	MTEF4_MOUSE Transcription termination factor 4, mitochondrial OS=Mus musculus OX=10090 GN=Mterf4 PE=2 SV=1
10	Q7Z6M4	1.92e-08	58.2	381	0.110	0.121	MTEF4_HUMAN Transcription termination factor 4, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=3
11	Q9LV83	5.37e-07	53.9	391	0.129	0.138	Q9LV83_ARATH Emb
12	Q0WRV2	6.37e-07	53.9	591	0.132	0.093	Q0WRV2_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=MTERF16 PE=1 SV=1
13	Q9ZT96	2.38e-05	48.9	541	0.120	0.092	MTEF4_ARATH Transcription termination factor MTERF4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF4 PE=1 SV=1
14	F4IHL3	1.10e-04	47.0	641	0.108	0.070	MTEF2_ARATH Transcription termination factor MTERF2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF2 PE=3 SV=1
15	Q9LHN2	4.28e-04	44.3	274	0.118	0.179	Q9LHN2_ARATH At3g18870 OS=Arabidopsis thaliana OX=3702 GN=MTERF11 PE=1 SV=1
16	Q9FK23	6.69e-04	44.3	500	0.098	0.082	MTEF8_ARATH Transcription termination factor MTERF8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF8 PE=1 SV=1
17	Q9FG25	0.003	42.7	1141	0.118	0.043	Q9FG25_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At5g06811 PE=3 SV=1
18	B6TGN4	0.011	40.4	494	0.108	0.091	MTEF4_MAIZE Transcription termination factor MTERF4, chloroplastic OS=Zea mays OX=4577 GN=MTERF4 PE=2 SV=1
19	Q9SJ50	0.018	39.3	333	0.115	0.144	SL1_ARATH Protein SEEDLING LETHAL 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SL1 PE=1 SV=1
20	O64685	0.022	38.9	303	0.101	0.139	O64685_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=MTERF10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02536 mTERF	2.6e-25	100.7	mTERF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000447651	0.929	Transcription termination factor 2, mitochondrial
2	9606.ENSP00000364204	0.911	Serine/threonine-protein kinase PINK1, mitochondrial
3	9606.ENSP00000304697	0.902	Polyubiquitin-B
4	9606.ENSP00000355865	0.902	E3 ubiquitin-protein ligase parkin
5	9606.ENSP00000441543	0.902	Polyubiquitin-C
6	9606.ENSP00000272317	0.901	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
8	9606.ENSP00000248643	0.863	Transcription termination factor 1, mitochondrial
9	9606.ENSP00000236980	0.859	FAST kinase domain-containing protein 2, mitochondrial
10	9606.ENSP00000341082	0.850	Mitochondrial ribosomal protein L20
11	9606.ENSP00000265333	0.835	Voltage-dependent anion-selective channel protein 1
12	9606.ENSP00000465759	0.832	DNA-directed RNA polymerase, mitochondrial
13	9606.ENSP00000355471	0.830	Dimethyladenosine transferase 2, mitochondrial
14	9606.ENSP00000332340	0.821	Probable ATP-dependent RNA helicase DDX28
15	9606.ENSP00000420617	0.811	Mitofusin-1
16	9606.ENSP00000235329	0.804	Mitofusin-2
17	9606.ENSP00000374455	0.800	Sequestosome-1
18	9606.ENSP00000356134	0.795	Dimethyladenosine transferase 1, mitochondrial
19	9606.ENSP00000419740	0.777	5-methylcytosine rRNA methyltransferase NSUN4
20	9606.ENSP00000279242	0.774	Mitochondrial ribosomal protein L49

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0003723	0.893	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0051172	0.985	negative regulation of nitrogen compound metabolic process
GO:0031324	0.985	negative regulation of cellular metabolic process
GO:0045892	0.978	negative regulation of DNA-templated transcription
GO:0009987	0.317	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.994	cytosol
GO:0016020	0.991	membrane
GO:0031966	0.955	mitochondrial membrane
GO:0070013	0.939	intracellular organelle lumen
GO:0032991	0.815	protein-containing complex
GO:0043232	0.772	intracellular non-membrane-bounded organelle
GO:0005759	0.738	mitochondrial matrix
GO:0019867	0.696	outer membrane
GO:0031968	0.694	organelle outer membrane
GO:0005741	0.653	mitochondrial outer membrane
GO:0019866	0.426	organelle inner membrane
GO:0005743	0.424	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]