StarFunc result for job id Q96E39

User Input

>input (390 residues)
MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGR
APLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSR
DSYSSSSRGAPRGAGPGGSRSDRGGGRSRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P38159	0.272	0.272	1.621E-49	391	0.954	0.951	P38159.pdb.gz	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
2	AFDB:J3KPK3	0.249	0.214	5.676E-28	459	0.585	0.497	J3KPK3.pdb.gz	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
3	AFDB:A6NDE4	0.263	0.213	1.013E-27	496	0.597	0.470	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
4	AFDB:O35698	0.242	0.248	1.909E-23	380	0.451	0.463	O35698.pdb.gz	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
5	AFDB:A3AT67	0.206	0.119	7.067E-12	684	0.208	0.118	A3AT67.pdb.gz	A3AT67_ORYSJ Branchpoint-bridging protein OS=Oryza sativa subsp. japonica OX=39947 GN=OsJ_14553 PE=3 SV=1
6	AFDB:Q9SEE9	0.214	0.202	1.183E-11	414	0.264	0.249	Q9SEE9.pdb.gz	SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana OX=3702 GN=SR45 PE=1 SV=1
7	AFDB:Q8WXF0	0.223	0.329	1.434E-11	261	0.169	0.253	Q8WXF0.pdb.gz	SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens OX=9606 GN=SRSF12 PE=2 SV=1
8	AFDB:Q57WI8	0.221	0.252	2.250E-11	340	0.185	0.212	Q57WI8.pdb.gz	Q57WI8_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.110 PE=4 SV=1
9	AFDB:Q84TH4	0.233	0.238	2.400E-11	382	0.279	0.285	Q84TH4.pdb.gz	SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana OX=3702 GN=SR45A PE=1 SV=1
10	AFDB:Q9LU44	0.210	0.103	2.729E-11	804	0.200	0.097	Q9LU44.pdb.gz	SF1_ARATH Splicing factor-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=SF1 PE=1 SV=1
11	PDB:7dvqY	0.199	0.541	9.869E-10	140	0.082	0.229	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:5yzg1	0.198	0.317	3.142E-9	243	0.082	0.132	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6y53o	0.199	0.476	4.930E-9	160	0.072	0.175	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:5gm6V	0.210	0.614	1.380E-8	128	0.072	0.219	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:6qx91K	0.206	0.395	1.570E-8	201	0.062	0.119	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
16	PDB:6gd1A	0.201	0.407	3.398E-8	190	0.069	0.142	6gd1A.pdb.gz
17	PDB:6g90B	0.199	0.396	4.687E-8	193	0.079	0.161	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:5xjcw	0.195	0.818	6.063E-8	91	0.062	0.264	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
19	PDB:6n7pA	0.197	0.406	8.919E-8	186	0.064	0.134	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:3lqvB	0.194	0.626	1.810E-7	115	0.054	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P84586	0.0	517	388	0.879	0.884	RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus OX=10116 GN=Rbmxrtl PE=1 SV=1
2	Q4V898	0.0	533	390	0.882	0.882	RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus OX=10116 GN=Rbmx PE=1 SV=1
3	Q91VM5	0.0	519	388	0.885	0.889	RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus OX=10090 GN=Rbmxl1 PE=2 SV=1
4	P38159	5.00e-179	505	391	0.897	0.895	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
5	J3KQ82	2.57e-105	320	459	0.567	0.481	J3KQ82_HUMAN RNA binding motif protein Y-linked family 1 member F OS=Homo sapiens OX=9606 GN=RBMY1F PE=4 SV=1
6	J3KPK3	1.75e-104	318	459	0.564	0.479	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
7	A6NEQ0	1.46e-99	306	496	0.479	0.377	RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=1 SV=1
8	Q15415	1.52e-99	306	496	0.479	0.377	RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens OX=9606 GN=RBMY1F PE=1 SV=2
9	P0C7P1	1.54e-99	306	496	0.479	0.377	RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens OX=9606 GN=RBMY1D PE=2 SV=1
10	A6NDE4	1.68e-99	306	496	0.479	0.377	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
11	P0DJD3	1.91e-99	306	496	0.479	0.377	RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens OX=9606 GN=RBMY1A1 PE=1 SV=1
12	P0DJD4	1.99e-99	306	496	0.479	0.377	RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens OX=9606 GN=RBMY1C PE=1 SV=1
13	O35698	4.42e-83	260	380	0.433	0.445	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
14	P60824	1.16e-31	120	172	0.144	0.326	CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus OX=10090 GN=Cirbp PE=1 SV=1
15	P60825	1.16e-31	120	172	0.144	0.326	CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Cirbp PE=2 SV=1
16	K7EPM4	2.83e-31	119	168	0.141	0.327	K7EPM4_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
17	Q14011	2.88e-31	119	172	0.141	0.320	CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
18	Q53XX5	2.88e-31	119	172	0.141	0.320	Q53XX5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=2 SV=1
19	K7EMY9	3.73e-31	118	159	0.141	0.346	K7EMY9_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
20	Q9DED4	4.89e-31	118	166	0.136	0.319	CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis OX=8355 GN=cirbp-b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14703 PHM7_cyt	7.9e+02	11.7	Cytosolic domain of 10TM putative phosphate transporter
2	PF08081 RBM1CTR	2.4e-19	80.4	RBM1CTR (NUC064) family
3	PF00076 RRM_1	1.3e-19	81.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF13893 RRM_5	5.8e+02	11.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF16367 RRM_7	12	17.4	RNA recognition motif
6	PF16842 RRM_occluded	5.5e+02	11.9	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247956	0.828	Zinc finger protein 317
2	9606.ENSP00000365439	0.707	Heterogeneous nuclear ribonucleoprotein K
3	9606.ENSP00000365950	0.707	RNA-binding protein 3
4	9606.ENSP00000365744	0.681	Proline-rich protein 3
5	9606.ENSP00000359645	0.667	RNA-binding motif protein, X chromosome
6	9606.ENSP00000430025	0.614	LYR motif containing 2
7	9606.ENSP00000260508	0.608	Kynurenine--oxoglutarate transaminase 3
8	9606.ENSP00000439479	0.567	DmX-like protein 1
9	9606.ENSP00000232978	0.564	NK-tumor recognition protein
10	9606.ENSP00000461425	0.559	Putative zinc finger protein 66
11	9606.ENSP00000364389	0.522	Dual specificity protein phosphatase CDC14B
12	9606.ENSP00000362110	0.505	Splicing factor 3A subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0003677	0.938	DNA binding
GO:0003729	0.930	mRNA binding
GO:0042802	0.892	identical protein binding
GO:0043565	0.534	sequence-specific DNA binding
GO:0000978	0.488	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.405	chromatin binding
GO:0019904	0.352	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0043170	0.977	macromolecule metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0048518	0.961	positive regulation of biological process
GO:0019219	0.948	regulation of nucleobase-containing compound metabolic process
GO:0034641	0.947	cellular nitrogen compound metabolic process
GO:1903311	0.938	regulation of mRNA metabolic process
GO:0016070	0.938	RNA metabolic process
GO:0010468	0.936	regulation of gene expression
GO:0048522	0.906	positive regulation of cellular process
GO:0051173	0.868	positive regulation of nitrogen compound metabolic process
GO:0010604	0.861	positive regulation of macromolecule metabolic process
GO:0031325	0.857	positive regulation of cellular metabolic process
GO:0010467	0.855	gene expression
GO:0000398	0.759	mRNA splicing, via spliceosome
GO:0043484	0.747	regulation of RNA splicing
GO:0048519	0.716	negative regulation of biological process
GO:0050684	0.694	regulation of mRNA processing
GO:0048024	0.683	regulation of mRNA splicing, via spliceosome
GO:0051172	0.679	negative regulation of nitrogen compound metabolic process
GO:0009889	0.657	regulation of biosynthetic process
GO:0010556	0.651	regulation of macromolecule biosynthetic process
GO:0031326	0.650	regulation of cellular biosynthetic process
GO:0051254	0.561	positive regulation of RNA metabolic process
GO:0071840	0.528	cellular component organization or biogenesis
GO:0016043	0.473	cellular component organization
GO:0006355	0.437	regulation of DNA-templated transcription
GO:0048523	0.403	negative regulation of cellular process
GO:0043933	0.394	protein-containing complex organization
GO:0050896	0.373	response to stimulus
GO:0010557	0.328	positive regulation of macromolecule biosynthetic process
GO:0031328	0.318	positive regulation of cellular biosynthetic process
GO:0000245	0.307	spliceosomal complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.979	nucleoplasm
GO:0043228	0.813	non-membrane-bounded organelle
GO:0043232	0.803	intracellular non-membrane-bounded organelle
GO:0032991	0.628	protein-containing complex
GO:0005737	0.550	cytoplasm
GO:1990904	0.478	ribonucleoprotein complex
GO:0005681	0.442	spliceosomal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]