StarFunc result for job id Q96E52

User Input

>input (524 residues)
MSFICGLQSAARNHVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVNKYQGLGVNQCDR
WSFLPGNFHFYSTFNNKRTGGLSSTKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPSLS
VLHPLSPASIRAIRNFHTSPRFQAAPVPLLLMILKPVQKLFAIIVGRGIRKWWQALPPNK
KEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLLGKEQFRLLSELE
YEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDVPGISQINWVIHVVDSPIINAFVL
PNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFLGMIFLTMIWA
ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQM
EFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLS
TKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96E52	1.000	1.000	2.275E-79	524	1.000	1.000	Q96E52.pdb.gz	OMA1_HUMAN Metalloendopeptidase OMA1, mitochondrial OS=Homo sapiens OX=9606 GN=OMA1 PE=1 SV=1
2	AFDB:Q9D8H7	0.681	0.685	1.685E-55	521	0.687	0.691	Q9D8H7.pdb.gz	OMA1_MOUSE Metalloendopeptidase OMA1, mitochondrial OS=Mus musculus OX=10090 GN=Oma1 PE=1 SV=1
3	AFDB:E9QBI7	0.658	0.720	6.700E-43	478	0.422	0.462	E9QBI7.pdb.gz	OMA1_DANRE Metalloendopeptidase OMA1, mitochondrial OS=Danio rerio OX=7955 GN=oma1 PE=3 SV=1
4	PDB:2yptA	0.268	0.318	9.698E-5	424	0.094	0.116	2yptA.pdb.gz	The Structural Basis of Zmpste24-Dependent Laminopathies.
5	PDB:5sytA	0.264	0.303	9.759E-4	444	0.080	0.095	5sytA.pdb.gz	Human CaaX protease ZMPSTE24 expressed in yeast: Structure and inhibition by HIV protease inhibitors.
6	PDB:6aitA	0.247	0.305	1.135E-3	418	0.069	0.086	6aitA.pdb.gz	Structural Basis for the Function of the beta-Barrel Assembly-Enhancing Protease BepA.
7	AFDB:Q9NRK6	0.076	0.059	9.531E-3	738	0.124	0.088	Q9NRK6.pdb.gz	ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB10 PE=1 SV=2
8	AFDB:Q6IVC2	0.097	0.106	1.655E-2	472	0.120	0.133	Q6IVC2.pdb.gz	TGAL1_ORYSJ Transcription factor TGAL1 OS=Oryza sativa subsp. japonica OX=39947 GN=TGAL1 PE=1 SV=2
9	AFDB:O94364	0.119	0.107	1.925E-2	602	0.088	0.076	O94364.pdb.gz	WAPL_SCHPO Wings apart-like protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wpl1 PE=3 SV=1
10	AFDB:Q9VDG2	0.101	0.089	2.474E-2	625	0.122	0.102	Q9VDG2.pdb.gz	RLIP_DROME RalA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Rlip PE=1 SV=1
11	AFDB:Q0KHQ5	0.081	0.044	2.601E-2	1039	0.115	0.058	Q0KHQ5.pdb.gz	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
12	AFDB:Q5U154	0.094	0.064	2.601E-2	855	0.132	0.081	Q5U154.pdb.gz	Q5U154_DROME RE01051p OS=Drosophila melanogaster OX=7227 GN=Sln PE=2 SV=1
13	AFDB:Q55DA7	0.101	0.071	4.296E-2	824	0.132	0.084	Q55DA7.pdb.gz	ABCB7_DICDI ABC transporter B family member 7 OS=Dictyostelium discoideum OX=44689 GN=abcB7 PE=3 SV=1
14	PDB:3zukA	0.168	0.138	6.615E-2	657	0.086	0.068	3zukA.pdb.gz	Crystal Structure of Mycobacterium Tuberculosis Zinc-Dependent Metalloprotease-1 (Zmp1), a Metalloprotease Involved in Pathogenicity.
15	PDB:6oz6D	0.088	0.130	2.836E-1	288	0.082	0.149	6oz6D.pdb.gz	Chemical logic of MraY inhibition by antibacterial nucleoside natural products.
16	PDB:7mq8SB	0.091	0.103	4.030E-1	440	0.073	0.086	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6kswA	0.117	0.119	5.446E-1	513	0.059	0.060	6kswA.pdb.gz
18	PDB:7a6uA	0.063	0.095	6.021E-1	332	0.044	0.069	7a6uA.pdb.gz
19	PDB:7o3vF	0.088	0.136	6.021E-1	261	0.069	0.138	7o3vF.pdb.gz
20	PDB:6pyzA	0.103	0.138	6.999E-1	353	0.086	0.127	6pyzA.pdb.gz	Structural Basis of Inhibitor Selectivity in Human Indoleamine 2,3-Dioxygenase 1 and Tryptophan Dioxygenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96E52	0.0	1087	524	1.000	1.000	OMA1_HUMAN Metalloendopeptidase OMA1, mitochondrial OS=Homo sapiens OX=9606 GN=OMA1 PE=1 SV=1
2	Q9D8H7	0.0	755	521	0.714	0.718	OMA1_MOUSE Metalloendopeptidase OMA1, mitochondrial OS=Mus musculus OX=10090 GN=Oma1 PE=1 SV=1
3	E9QBI7	1.12e-147	434	478	0.412	0.452	OMA1_DANRE Metalloendopeptidase OMA1, mitochondrial OS=Danio rerio OX=7955 GN=oma1 PE=3 SV=1
4	Q9P7G4	2.26e-36	140	337	0.176	0.273	OMA1_SCHPO Mitochondrial metalloendopeptidase OMA1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oma1 PE=3 SV=1
5	P36163	2.99e-31	125	345	0.141	0.214	OMA1_YEAST Mitochondrial metalloendopeptidase OMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OMA1 PE=1 SV=2
6	Q5A663	1.25e-22	101	336	0.143	0.223	OMA1_CANAL Mitochondrial metalloendopeptidase OMA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OMA1 PE=3 SV=1
7	P25894	1.55e-07	55.1	252	0.080	0.167	LOIP_ECOLI Metalloprotease LoiP OS=Escherichia coli (strain K12) OX=83333 GN=loiP PE=1 SV=2
8	O53978	5.27e-07	53.9	348	0.069	0.103	O53978_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1977 PE=1 SV=1
9	P43674	9.13e-06	49.7	254	0.082	0.169	YCAL_ECOLI Metalloprotease YcaL OS=Escherichia coli (strain K12) OX=83333 GN=ycaL PE=1 SV=3
10	P66948	2.95e-05	48.9	487	0.073	0.078	BEPA_ECOLI Beta-barrel assembly-enhancing protease OS=Escherichia coli (strain K12) OX=83333 GN=bepA PE=1 SV=1
11	Q6RI63	1.8	33.9	786	0.124	0.083	F120B_MOUSE Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Mus musculus OX=10090 GN=Fam120b PE=1 SV=1
12	O75344	2.6	33.1	327	0.029	0.046	FKBP6_HUMAN Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Homo sapiens OX=9606 GN=FKBP6 PE=1 SV=1
13	Q91XW8	2.7	32.7	327	0.027	0.043	FKBP6_MOUSE Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Mus musculus OX=10090 GN=Fkbp6 PE=1 SV=1
14	D3ZQF4	3.9	32.3	327	0.027	0.043	FKBP6_RAT Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Rattus norvegicus OX=10116 GN=Fkbp6 PE=3 SV=1
15	Q8BSY6	5.1	32.3	508	0.029	0.030	Q8BSY6_MOUSE BTB domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Kbtbd2 PE=2 SV=1
16	Q61001	5.7	32.3	3718	0.031	0.004	LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus OX=10090 GN=Lama5 PE=1 SV=4
17	Q9ZNS0	6.1	32.0	508	0.053	0.055	PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana OX=3702 GN=PLT3 PE=3 SV=1
18	G3X9X1	6.8	32.0	623	0.029	0.024	KBTB2_MOUSE Kelch repeat and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Kbtbd2 PE=1 SV=1
19	Q587C2	7.5	31.6	407	0.046	0.059	Q587C2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.580 PE=1 SV=1
20	Q6ZPP6	7.5	32.0	627	0.029	0.024	Q6ZPP6_MOUSE MKIAA1489 protein (Fragment) OS=Mus musculus OX=10090 GN=Kbtbd2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17733 DUF5572	2.1e+02	13.2	Family of unknown function (DUF5572)
2	PF01435 Peptidase_M48	2.2e-25	101.2	Peptidase family M48

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354681	0.968	Dynamin-like 120 kDa protein, mitochondrial
2	9606.ENSP00000318480	0.939	ATP-dependent zinc metalloprotease YME1L1
3	9606.ENSP00000269143	0.844	AFG3-like protein 2
4	9606.ENSP00000325421	0.843	Presenilins-associated rhomboid-like protein, mitochondrial
5	9606.ENSP00000268704	0.772	Paraplegin
6	9606.ENSP00000420617	0.768	Mitofusin-1
7	9606.ENSP00000300145	0.763	Mitochondrial inner membrane protease ATP23 homolog
8	9606.ENSP00000441875	0.728	Prohibitin-2
9	9606.ENSP00000235329	0.716	Mitofusin-2
10	9606.ENSP00000418734	0.705	Histone H2A deubiquitinase MYSM1
11	9606.ENSP00000359305	0.682	Transmembrane emp24 domain-containing protein 5
12	9606.ENSP00000245816	0.653	ATP-dependent Clp protease proteolytic subunit, mitochondrial
13	9606.ENSP00000223136	0.650	Mitochondrial fission 1 protein
14	9606.ENSP00000349658	0.646	X-prolyl aminopeptidase 3
15	9606.ENSP00000384966	0.646	Mitochondrial inner membrane protease subunit 2
16	9606.ENSP00000449089	0.639	Dynamin-1-like protein
17	9606.ENSP00000302037	0.638	Mitochondrial fission factor
18	9606.ENSP00000238561	0.636	Uncharacterized aarF domain-containing protein kinase 1
19	9606.ENSP00000269051	0.635	Rhomboid-related protein 3
20	9606.ENSP00000344206	0.631	Rhomboid-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0005488	0.870	binding
GO:0005515	0.844	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0044238	0.989	primary metabolic process
GO:0009987	0.987	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0071704	0.977	organic substance metabolic process
GO:0010821	0.974	regulation of mitochondrion organization
GO:0006508	0.968	proteolysis
GO:0050896	0.965	response to stimulus
GO:0010823	0.954	negative regulation of mitochondrion organization
GO:0048518	0.934	positive regulation of biological process
GO:0048522	0.834	positive regulation of cellular process
GO:0051603	0.732	proteolysis involved in protein catabolic process
GO:0006515	0.664	protein quality control for misfolded or incompletely synthesized proteins
GO:0071840	0.608	cellular component organization or biogenesis
GO:0051716	0.596	cellular response to stimulus
GO:0016043	0.581	cellular component organization
GO:0010941	0.545	regulation of cell death
GO:0016485	0.524	protein processing
GO:0022603	0.520	regulation of anatomical structure morphogenesis
GO:0007005	0.462	mitochondrion organization
GO:0051093	0.418	negative regulation of developmental process
GO:0044237	0.404	cellular metabolic process
GO:0010942	0.300	positive regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:0031974	0.729	membrane-enclosed lumen
GO:0070013	0.718	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]