StarFunc result for job id Q96EA4

User Input

>input (605 residues)
MEADIITNLRCRLKEAEEERLKAAQYGLQLVESQNELQNQLDKCRNEMMTMTESYEQEKY
TLQREVELKSRMLESLSCECEAIKQQQKMHLEKLEEQLSRSHGQEVNELKTKIEKLKVEL
DEARLSEKQLKHQVDHQKELLSCKSEELRVMSERVQESMSSEMLALQIELTEMESMKTTL
KEEVNELQYRQEQLELLITNLMRQVDRLKEEKEEREKEAVSYYNALEKARVANQDLQVQL
DQALQQALDPNSKGNSLFAEVEDRRAAMERQLISMKVKYQSLKKQNVFNREQMQRMKLQI
ATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSMESKPSVDSGT
LEDNTYYTDLLQMKLDNLNKEIESTKGELSIQRMKALFESQRALDIERKLFANERCLQLS
ESENMKLRAKLDELKLKYEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRL
PPQKEETQSCPNSLEDNNLQLEKSVSIYTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPA
DAEALSERSGNTPNSPRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPET
QCPQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EA4	1.000	1.000	2.636E-79	605	1.000	1.000	Q96EA4.pdb.gz	SPDLY_HUMAN Protein Spindly OS=Homo sapiens OX=9606 GN=SPDL1 PE=1 SV=2
2	AFDB:F4IIV5	0.130	0.075	4.342E-6	1297	0.159	0.074	F4IIV5.pdb.gz	F4IIV5_ARATH Maternal effect embryo arrest 22 OS=Arabidopsis thaliana OX=3702 GN=MEE22 PE=1 SV=1
3	AFDB:Q80UK7	0.116	0.109	6.516E-6	654	0.149	0.138	Q80UK7.pdb.gz	SAS6_MOUSE Spindle assembly abnormal protein 6 homolog OS=Mus musculus OX=10090 GN=Sass6 PE=2 SV=2
4	AFDB:M9MRX0	0.122	0.082	8.540E-6	989	0.152	0.093	M9MRX0.pdb.gz	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
5	AFDB:Q6UVJ0	0.142	0.131	9.138E-6	657	0.145	0.134	Q6UVJ0.pdb.gz	SAS6_HUMAN Spindle assembly abnormal protein 6 homolog OS=Homo sapiens OX=9606 GN=SASS6 PE=1 SV=1
6	AFDB:Q38DW1	0.131	0.110	1.798E-5	726	0.160	0.134	Q38DW1.pdb.gz	Q38DW1_TRYB2 Spindle assembly abnormal protein 6 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1930 PE=4 SV=1
7	AFDB:Q387K6	0.129	0.097	2.058E-5	821	0.167	0.123	Q387K6.pdb.gz	Q387K6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0690 PE=4 SV=1
8	AFDB:A0A166B1A6	0.122	0.076	2.697E-5	1119	0.195	0.105	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
9	AFDB:P49455	0.135	0.155	3.304E-5	518	0.134	0.156	P49455.pdb.gz	TPM4_DROME Tropomyosin-1, isoforms 33/34 OS=Drosophila melanogaster OX=7227 GN=Tm1 PE=2 SV=2
10	AFDB:Q00083	0.131	0.049	3.536E-5	1676	0.122	0.044	Q00083.pdb.gz	APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=apsA PE=1 SV=2
11	PDB:7utlV	0.109	0.293	4.371	170	0.051	0.182	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
12	PDB:2l9qA	0.045	0.220	7.509	109	0.018	0.101	2l9qA.pdb.gz
13	PDB:7y4sA	0.109	0.172	7.509	343	0.046	0.082	7y4sA.pdb.gz
14	PDB:5xtdW	0.066	0.193	8.035	138	0.040	0.174	5xtdW.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
15	PDB:6oy3B	0.035	0.035	8.035	594	0.013	0.013	6oy3B.pdb.gz	Dynamic modulation of the lipid translocation groove generates a conductive ion channel in Ca 2+ -bound nhTMEM16.
16	PDB:7r5jV0	0.064	0.141	8.035	273	0.064	0.143	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:7sqkC	0.090	0.090	8.035	600	0.093	0.093	7sqkC.pdb.gz
18	PDB:4cfgA	0.123	0.356	9.199	164	0.050	0.183	4cfgA.pdb.gz
19	PDB:6yxxAI	0.048	0.091	9.843	240	0.025	0.062	6yxxAI.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EA4	0.0	1207	605	1.000	1.000	SPDLY_HUMAN Protein Spindly OS=Homo sapiens OX=9606 GN=SPDL1 PE=1 SV=2
2	C1P641	7.26e-04	45.4	3663	0.150	0.025	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
3	G5EEV6	7.26e-04	45.4	3704	0.150	0.025	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
4	C1P640	7.51e-04	45.4	3683	0.150	0.025	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
5	Q21313	7.51e-04	45.4	3672	0.150	0.025	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
6	Q9VQS4	0.019	40.4	781	0.040	0.031	Q9VQS4_DROME Spindly OS=Drosophila melanogaster OX=7227 GN=Spindly PE=4 SV=2
7	Q8CHW5	0.078	38.5	507	0.088	0.105	BICL2_MOUSE BICD family-like cargo adapter 2 OS=Mus musculus OX=10090 GN=Bicdl2 PE=1 SV=1
8	P0CF95	0.20	37.0	569	0.076	0.081	BICL1_DANRE BICD family-like cargo adapter 1 OS=Danio rerio OX=7955 GN=bicdl1 PE=2 SV=1
9	A1A5D9	0.39	36.2	508	0.084	0.100	BICL2_HUMAN BICD family-like cargo adapter 2 OS=Homo sapiens OX=9606 GN=BICDL2 PE=1 SV=2
10	A0JNT9	1.0	34.7	577	0.063	0.066	BICL1_MOUSE BICD family-like cargo adapter 1 OS=Mus musculus OX=10090 GN=Bicdl1 PE=1 SV=1
11	Q9JK25	1.1	35.0	1320	0.093	0.042	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
12	P58301	1.3	34.7	882	0.074	0.051	RAD50_PYRFU DNA double-strand break repair Rad50 ATPase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=rad50 PE=1 SV=1
13	Q38FY7	1.5	34.3	1605	0.084	0.032	Q38FY7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0520 PE=4 SV=1
14	P30622	3.2	33.5	1438	0.091	0.038	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
15	P14105	4.0	33.1	1959	0.060	0.018	MYH9_CHICK Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 PE=2 SV=1
16	Q23529	4.0	33.1	777	0.122	0.095	HOOK_CAEEL Zygote defective protein 12 OS=Caenorhabditis elegans OX=6239 GN=zyg-12 PE=1 SV=5
17	Q3ZU82	5.2	32.7	728	0.041	0.034	GOGA5_RAT Golgin subfamily A member 5 OS=Rattus norvegicus OX=10116 GN=Golga5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04508 Pox_A_type_inc	1.1e+02	14.0	Viral A-type inclusion protein repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287598	0.983	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
2	9606.ENSP00000319417	0.978	Spindle and kinetochore-associated protein 3
3	9606.ENSP00000285116	0.972	Spindle and kinetochore-associated protein 1
4	9606.ENSP00000355922	0.966	Centromere protein F
5	9606.ENSP00000261597	0.962	Kinetochore protein NDC80 homolog
6	9606.ENSP00000302530	0.950	Mitotic checkpoint serine/threonine-protein kinase BUB1
7	9606.ENSP00000311429	0.920	Protein zwilch homolog
8	9606.ENSP00000333433	0.916	Spindle and kinetochore-associated protein 2
9	9606.ENSP00000256442	0.902	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000309644	0.902	Biorientation of chromosomes in cell division protein 1
11	9606.ENSP00000305204	0.884	Cytoskeleton-associated protein 2-like
12	9606.ENSP00000265148	0.863	Centromere-associated protein E
13	9606.ENSP00000349961	0.840	Structural maintenance of chromosomes protein 4
14	9606.ENSP00000376457	0.838	Protein ECT2
15	9606.ENSP00000300093	0.836	Serine/threonine-protein kinase PLK1
16	9606.ENSP00000356379	0.821	Abnormal spindle-like microcephaly-associated protein
17	9606.ENSP00000378356	0.813	Kinesin-like protein KIF20A
18	9606.ENSP00000335062	0.807	Programmed cell death protein 1
19	9606.ENSP00000362146	0.806	Borealin
20	9606.ENSP00000298048	0.801	Maternal embryonic leucine zipper kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043515	1.000	kinetochore binding
GO:0019899	1.000	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0098813	0.988	nuclear chromosome segregation
GO:0000226	0.988	microtubule cytoskeleton organization
GO:0051276	0.987	chromosome organization
GO:1903047	0.977	mitotic cell cycle process
GO:0000280	0.970	nuclear division
GO:1902850	0.965	microtubule cytoskeleton organization involved in mitosis
GO:0050000	0.950	chromosome localization
GO:0000070	0.947	mitotic sister chromatid segregation
GO:0051656	0.934	establishment of organelle localization
GO:0051653	0.933	spindle localization
GO:0034502	0.931	protein localization to chromosome
GO:0051649	0.929	establishment of localization in cell
GO:0007163	0.910	establishment or maintenance of cell polarity
GO:0040001	0.905	establishment of mitotic spindle localization
GO:0051310	0.895	metaphase plate congression
GO:0007080	0.856	mitotic metaphase plate congression
GO:0071459	0.822	protein localization to chromosome, centromeric region
GO:0030010	0.807	establishment of cell polarity
GO:0050794	0.799	regulation of cellular process
GO:0051294	0.781	establishment of spindle orientation
GO:0000132	0.768	establishment of mitotic spindle orientation
GO:1903083	0.756	protein localization to condensed chromosome
GO:0034501	0.705	protein localization to kinetochore
GO:0048870	0.539	cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0000922	0.998	spindle pole
GO:0000940	0.998	outer kinetochore
GO:0070013	0.837	intracellular organelle lumen
GO:0031981	0.802	nuclear lumen
GO:0005815	0.621	microtubule organizing center
GO:0005654	0.558	nucleoplasm
GO:0005813	0.513	centrosome
GO:0016020	0.485	membrane
GO:0012505	0.319	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]