StarFunc result for job id Q96EB6

User Input

>input (747 residues)
MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F8W3	0.461	0.484	1.394E-75	710	0.517	0.544	E7F8W3.pdb.gz	E7F8W3_DANRE NAD-dependent protein deacetylase sirtuin-1 isoform X1 OS=Danio rerio OX=7955 GN=sirt1 PE=1 SV=1
2	AFDB:Q21921	0.452	0.549	1.142E-48	607	0.284	0.349	Q21921.pdb.gz	SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans OX=6239 GN=sir-2.1 PE=1 SV=1
3	PDB:5fyqA	0.325	0.834	2.255E-24	282	0.153	0.404	5fyqA.pdb.gz	Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
4	PDB:1q14A	0.290	0.710	4.075E-18	289	0.120	0.311	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
5	PDB:3u31A	0.304	0.813	5.646E-15	263	0.087	0.247	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine
6	PDB:6fkyB	0.267	0.691	2.875E-14	266	0.091	0.256	6fkyB.pdb.gz	Potent and Selective Inhibitors of Human Sirtuin 5.
7	PDB:7cl1A	0.243	0.568	9.037E-14	296	0.076	0.193	7cl1A.pdb.gz	Reply to: Binding site for MDL-801 on SIRT6.
8	AFDB:A0A0X1KG68	0.078	0.074	1.138E-2	792	0.119	0.112	A0A0X1KG68.pdb.gz
9	AFDB:G0SB31	0.073	0.072	1.634E-2	765	0.112	0.110	G0SB31.pdb.gz	SKN7_CHATD Transcription factor SKN7 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=SKN7 PE=1 SV=1
10	AFDB:Q9C0D7	0.065	0.056	2.647E-2	883	0.130	0.110	Q9C0D7.pdb.gz	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
11	PDB:4o9uB	0.133	0.217	6.159E-2	440	0.052	0.089	4o9uB.pdb.gz	Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer.
12	PDB:6hyjB	0.137	0.354	2.617E-1	223	0.031	0.103	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
13	PDB:5eanA	0.070	0.055	2.952E-1	1051	0.047	0.033	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
14	PDB:3ey9A	0.115	0.147	4.239E-1	571	0.039	0.051	3ey9A.pdb.gz	Structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from Escherichia coli.
15	PDB:2q28A	0.126	0.169	4.782E-1	550	0.032	0.044	2q28A.pdb.gz	New insights into structure-function relationships of oxalyl CoA decarboxylase from Escherichia coli.
16	AFDB:Q0KIC3	0.042	0.025	1.181	1372	0.173	0.094	Q0KIC3.pdb.gz	Y3427_DROME Uncharacterized protein CG43427 OS=Drosophila melanogaster OX=7227 GN=CG43427 PE=2 SV=1
17	AFDB:Q7K480	0.083	0.052	1.332	1367	0.151	0.083	Q7K480.pdb.gz	MEPCE_DROME 7SK snRNA methylphosphate capping enzyme bin3 OS=Drosophila melanogaster OX=7227 GN=bin3 PE=1 SV=1
18	AFDB:F1NSK6	0.053	0.052	1.415	766	0.134	0.131	F1NSK6.pdb.gz
19	AFDB:F1QZ88	0.063	0.056	1.695	917	0.131	0.107	F1QZ88.pdb.gz	E2F8_DANRE Transcription factor E2F8 OS=Danio rerio OX=7955 GN=e2f8 PE=3 SV=1
20	AFDB:Q9R0I7	0.066	0.039	2.157	1386	0.135	0.073	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZ79	0.0	991	555	0.676	0.910	SIR1_RAT NAD-dependent protein deacetylase sirtuin-1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=3 SV=2
2	A7LKB1	0.0	1254	742	0.897	0.903	A7LKB1_PIG NAD-dependent protein deacetylase sirtuin-1 isoform a OS=Sus scrofa OX=9823 GN=SIRT1 PE=2 SV=2
3	B0QZ35	0.0	892	444	0.581	0.977	B0QZ35_HUMAN Sirtuin 1 OS=Homo sapiens OX=9606 GN=SIRT1 PE=1 SV=1
4	B3FK65	0.0	1249	742	0.894	0.900	B3FK65_PIG Sirtuin 1 OS=Sus scrofa OX=9823 PE=4 SV=1
5	E7F8W3	0.0	663	710	0.452	0.476	E7F8W3_DANRE NAD-dependent protein deacetylase sirtuin-1 isoform X1 OS=Danio rerio OX=7955 GN=sirt1 PE=1 SV=1
6	E9PC49	0.0	933	452	0.605	1.000	E9PC49_HUMAN Sirtuin 1 OS=Homo sapiens OX=9606 GN=SIRT1 PE=1 SV=1
7	Q923E4	0.0	1148	737	0.846	0.858	SIR1_MOUSE NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus OX=10090 GN=Sirt1 PE=1 SV=2
8	Q96EB6	0.0	1527	747	1.000	1.000	SIR1_HUMAN NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1 PE=1 SV=2
9	Q9VK34	3.88e-136	424	823	0.277	0.252	SIRT1_DROME NAD-dependent histone deacetylase sirtuin-1 OS=Drosophila melanogaster OX=7227 GN=Sirt1 PE=1 SV=1
10	Q21921	1.03e-107	343	607	0.220	0.270	SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans OX=6239 GN=sir-2.1 PE=1 SV=1
11	D3YT50	1.45e-107	341	577	0.220	0.284	D3YT50_CAEEL Deacetylase sirtuin-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sir-2.1 PE=1 SV=1
12	Q54GV7	8.17e-86	283	542	0.199	0.275	SIR2D_DICDI NAD-dependent deacetylase sir2D OS=Dictyostelium discoideum OX=44689 GN=sir2D PE=2 SV=1
13	C8V3W5	4.66e-81	269	489	0.209	0.319	HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN10449 PE=3 SV=1
14	O94640	1.53e-68	235	475	0.209	0.328	SIR2_SCHPO NAD-dependent histone deacetylase sir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sir2 PE=1 SV=2
15	Q8VDQ8	2.99e-66	226	389	0.166	0.319	SIR2_MOUSE NAD-dependent protein deacetylase sirtuin-2 OS=Mus musculus OX=10090 GN=Sirt2 PE=1 SV=2
16	O59923	4.10e-66	229	519	0.157	0.225	SIR2_CANAL NAD-dependent histone deacetylase SIR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIR2 PE=1 SV=2
17	P53685	1.40e-65	228	503	0.163	0.243	HST1_YEAST NAD-dependent protein deacetylase HST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HST1 PE=1 SV=1
18	Q6FNA6	3.79e-65	227	519	0.166	0.239	Q6FNA6_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SIR2 PE=3 SV=1
19	Q6FWI7	4.35e-64	224	509	0.158	0.232	SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SIR2 PE=3 SV=1
20	Q5RJQ4	4.67e-64	219	350	0.159	0.340	SIR2_RAT NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus OX=10116 GN=Sirt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04574 DUF592	29	15.9	Protein of unknown function (DUF592)
2	PF02146 SIR2	5.7e-61	217.1	Sir2 family
3	PF00205 TPP_enzyme_M	14	16.9	Thiamine pyrophosphate enzyme, central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000212015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
2	9606.ENSP00000264867	0.999	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
3	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
4	9606.ENSP00000308741	0.999	Circadian locomoter output cycles protein kaput
5	9606.ENSP00000337976	0.999	Histone-lysine N-methyltransferase SUV39H1
6	9606.ENSP00000368880	0.999	Forkhead box protein O1
7	9606.ENSP00000384517	0.999	Aryl hydrocarbon receptor nuclear translocator-like protein 1
8	9606.ENSP00000385824	0.999	Forkhead box protein O3
9	9606.ENSP00000287820	0.998	Peroxisome proliferator-activated receptor gamma
10	9606.ENSP00000384273	0.998	Transcription factor p65
11	9606.ENSP00000250003	0.997	Myoblast determination protein 1
12	9606.ENSP00000268712	0.997	Nuclear receptor corepressor 1
13	9606.ENSP00000333948	0.997	Active regulator of SIRT1
14	9606.ENSP00000264606	0.996	Histone deacetylase 4
15	9606.ENSP00000310670	0.996	Cell cycle and apoptosis regulator protein 2
16	9606.ENSP00000352257	0.996	X-ray repair cross-complementing protein 6
17	9606.ENSP00000254605	0.994	Ribosomal RNA-processing protein 8
18	9606.ENSP00000385523	0.994	Peroxisome proliferator-activated receptor alpha
19	9606.ENSP00000314080	0.993	Hypermethylated in cancer 1 protein
20	9606.ENSP00000263754	0.992	Histone acetyltransferase KAT2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0033558	0.996	protein lysine deacetylase activity
GO:0089720	0.993	caspase binding
GO:0017136	0.985	NAD-dependent histone deacetylase activity
GO:1901363	0.983	heterocyclic compound binding
GO:0097159	0.862	organic cyclic compound binding
GO:0034739	0.449	histone H4K16 deacetylase activity
GO:0140110	0.404	transcription regulator activity
GO:0003676	0.400	nucleic acid binding
GO:0016740	0.339	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062012	0.996	regulation of small molecule metabolic process
GO:0048522	0.996	positive regulation of cellular process
GO:0051174	0.996	regulation of phosphorus metabolic process
GO:0042981	0.996	regulation of apoptotic process
GO:0008219	0.995	cell death
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0009893	0.995	positive regulation of metabolic process
GO:0035556	0.995	intracellular signal transduction
GO:0051246	0.994	regulation of protein metabolic process
GO:0019219	0.994	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.994	positive regulation of cellular metabolic process
GO:0097190	0.994	apoptotic signaling pathway
GO:0031326	0.993	regulation of cellular biosynthetic process
GO:0010468	0.990	regulation of gene expression
GO:0048519	0.987	negative regulation of biological process
GO:0008152	0.981	metabolic process
GO:2000772	0.981	regulation of cellular senescence
GO:0045935	0.980	positive regulation of nucleobase-containing compound metabolic process
GO:0097193	0.979	intrinsic apoptotic signaling pathway
GO:0009894	0.978	regulation of catabolic process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0019220	0.977	regulation of phosphate metabolic process
GO:0016043	0.973	cellular component organization
GO:0031324	0.972	negative regulation of cellular metabolic process
GO:0062013	0.971	positive regulation of small molecule metabolic process
GO:0023051	0.968	regulation of signaling
GO:0010646	0.968	regulation of cell communication
GO:1901984	0.965	negative regulation of protein acetylation
GO:0045937	0.963	positive regulation of phosphate metabolic process
GO:0048583	0.962	regulation of response to stimulus
GO:0009891	0.957	positive regulation of biosynthetic process
GO:0043069	0.957	negative regulation of programmed cell death
GO:0031328	0.953	positive regulation of cellular biosynthetic process
GO:0071704	0.952	organic substance metabolic process
GO:0044238	0.950	primary metabolic process
GO:0043065	0.948	positive regulation of apoptotic process
GO:0031329	0.935	regulation of cellular catabolic process
GO:0009890	0.935	negative regulation of biosynthetic process
GO:0009896	0.930	positive regulation of catabolic process
GO:0043066	0.930	negative regulation of apoptotic process
GO:0006950	0.927	response to stress
GO:0006807	0.925	nitrogen compound metabolic process
GO:0010629	0.907	negative regulation of gene expression
GO:0033554	0.903	cellular response to stress
GO:0051247	0.894	positive regulation of protein metabolic process
GO:1904035	0.891	regulation of epithelial cell apoptotic process
GO:0010648	0.890	negative regulation of cell communication
GO:0051239	0.889	regulation of multicellular organismal process
GO:0006996	0.886	organelle organization
GO:0019216	0.874	regulation of lipid metabolic process
GO:0065008	0.873	regulation of biological quality
GO:1900542	0.871	regulation of purine nucleotide metabolic process
GO:0043170	0.868	macromolecule metabolic process
GO:0050793	0.848	regulation of developmental process
GO:1901564	0.837	organonitrogen compound metabolic process
GO:0023057	0.817	negative regulation of signaling
GO:0031331	0.817	positive regulation of cellular catabolic process
GO:0009966	0.810	regulation of signal transduction
GO:0036211	0.789	protein modification process
GO:0010556	0.775	regulation of macromolecule biosynthetic process
GO:1903578	0.773	regulation of ATP metabolic process
GO:0006974	0.771	cellular response to DNA damage stimulus
GO:0048585	0.761	negative regulation of response to stimulus
GO:1902531	0.748	regulation of intracellular signal transduction
GO:1900544	0.746	positive regulation of purine nucleotide metabolic process
GO:0080134	0.716	regulation of response to stress
GO:0009968	0.698	negative regulation of signal transduction
GO:0044237	0.697	cellular metabolic process
GO:1904037	0.692	positive regulation of epithelial cell apoptotic process
GO:1900371	0.670	regulation of purine nucleotide biosynthetic process
GO:1903580	0.670	positive regulation of ATP metabolic process
GO:0030810	0.668	positive regulation of nucleotide biosynthetic process
GO:0051093	0.666	negative regulation of developmental process
GO:0008630	0.649	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0032501	0.645	multicellular organismal process
GO:0032502	0.583	developmental process
GO:0051252	0.577	regulation of RNA metabolic process
GO:0042221	0.532	response to chemical
GO:0048856	0.528	anatomical structure development
GO:2001141	0.527	regulation of RNA biosynthetic process
GO:0065009	0.518	regulation of molecular function
GO:0006355	0.488	regulation of DNA-templated transcription
GO:0006476	0.442	protein deacetylation
GO:0006357	0.439	regulation of transcription by RNA polymerase II
GO:0070887	0.421	cellular response to chemical stimulus
GO:0010033	0.396	response to organic substance
GO:0010557	0.390	positive regulation of macromolecule biosynthetic process
GO:0016570	0.368	histone modification
GO:0016575	0.359	histone deacetylation
GO:0031327	0.315	negative regulation of cellular biosynthetic process
GO:0051094	0.307	positive regulation of developmental process
GO:0051254	0.307	positive regulation of RNA metabolic process
GO:1902679	0.305	negative regulation of RNA biosynthetic process
GO:0051240	0.301	positive regulation of multicellular organismal process
GO:0045893	0.301	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005829	0.971	cytosol
GO:0005739	0.711	mitochondrion
GO:0005730	0.549	nucleolus
GO:0032991	0.544	protein-containing complex
GO:0005694	0.412	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58108	0.996	H2O + N(6)-acetyl-L-lysyl-[protein] = acetate + L-lysyl-[protein]
RHEA:58196	0.991	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.991	histone deacetylase.
EC:2.-.-.-	0.339	Transferases.

[back to server]