StarFunc result for job id Q96EE4

User Input

>input (140 residues)
MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKAL
AEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGT
SGNLVPVTTNKRTNVSGSIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EE4	1.000	1.000	2.712E-20	140	1.000	1.000	Q96EE4.pdb.gz	CC126_HUMAN Coiled-coil domain-containing protein 126 OS=Homo sapiens OX=9606 GN=CCDC126 PE=2 SV=2
2	AFDB:Q27411	0.169	0.058	2.993E-1	463	0.136	0.041	Q27411.pdb.gz	Q27411_DROME Rlb1 OS=Drosophila melanogaster OX=7227 GN=Rlb1 PE=1 SV=1
3	AFDB:Q6FNM3	0.245	0.129	1.162	300	0.150	0.070	Q6FNM3.pdb.gz	Q6FNM3_CANGA Candida glabrata strain CBS138 chromosome J complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0J10560g PE=4 SV=1
4	AFDB:A0A140LG70	0.238	0.173	1.968	198	0.129	0.091	A0A140LG70.pdb.gz	A0A140LG70_DANRE INO80 complex subunit E OS=Danio rerio OX=7955 GN=si:ch73-54f23.2 PE=4 SV=1
5	AFDB:Q4Q2K0	0.195	0.056	2.122	634	0.150	0.033	Q4Q2K0.pdb.gz	Q4Q2K0_LEIMA DNA topoisomerase I OS=Leishmania major OX=5664 GN=LMJF_34_3440 PE=3 SV=1
6	AFDB:Q9ATF1	0.226	0.139	2.288	245	0.186	0.106	Q9ATF1.pdb.gz	Q9ATF1_PETHY MADS-box transcription factor FBP9 OS=Petunia hybrida OX=4102 GN=FBP9 PE=1 SV=1
7	AFDB:P53075	0.201	0.075	2.467	577	0.114	0.028	P53075.pdb.gz	SHE10_YEAST Outer spore wall assembly protein SHE10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHE10 PE=1 SV=1
8	AFDB:A2AT93	0.288	0.164	3.093	255	0.171	0.094	A2AT93.pdb.gz	A2AT93_MOUSE Phospholipase C, beta 4 (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
9	AFDB:Q04087	0.284	0.122	3.093	347	0.121	0.049	Q04087.pdb.gz	LRS4_YEAST Monopolin complex subunit LRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LRS4 PE=1 SV=1
10	AFDB:Q54PN9	0.231	0.109	3.093	324	0.164	0.071	Q54PN9.pdb.gz	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
11	PDB:6t9iF	0.203	0.232	6.282	111	0.157	0.198	6t9iF.pdb.gz
12	PDB:7mqaSS	0.137	0.063	7.304	350	0.129	0.051	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6nd1A	0.093	0.038	9.872	461	0.114	0.035	6nd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EE4	3.89e-100	285	140	1.000	1.000	CC126_HUMAN Coiled-coil domain-containing protein 126 OS=Homo sapiens OX=9606 GN=CCDC126 PE=2 SV=2
2	Q1ECU6	2.38e-38	139	742	0.493	0.093	Q1ECU6_DANRE alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase OS=Danio rerio OX=7955 GN=zgc:136939 PE=2 SV=1
3	P97259	1.53e-37	137	740	0.521	0.099	MGT5A_CRIGR Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Cricetulus griseus OX=10029 GN=MGAT5 PE=1 SV=1
4	Q8R4G6	1.19e-36	134	740	0.550	0.104	MGT5A_MOUSE Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Mus musculus OX=10090 GN=Mgat5 PE=1 SV=1
5	Q09328	1.80e-33	125	741	0.457	0.086	MGT5A_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A OS=Homo sapiens OX=9606 GN=MGAT5 PE=1 SV=1
6	O00487	0.90	31.6	310	0.214	0.097	PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1
7	O35593	0.90	31.6	310	0.214	0.097	PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus OX=10090 GN=Psmd14 PE=1 SV=2
8	Q17QP9	0.90	31.6	310	0.214	0.097	Q17QP9_BOVIN Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Bos taurus OX=9913 GN=PSMD14 PE=1 SV=1
9	Q4V8E2	0.90	31.6	310	0.214	0.097	Q4V8E2_RAT Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
10	A0A0G2JZJ1	1.0	31.2	306	0.179	0.082	A0A0G2JZJ1_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
11	P52987	1.1	31.2	337	0.093	0.039	G3P_LACLA Glyceraldehyde-3-phosphate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=gap PE=3 SV=2
12	O76577	2.0	30.4	312	0.164	0.074	PSDE_CAEEL 26S proteasome non-ATPase regulatory subunit 14 OS=Caenorhabditis elegans OX=6239 GN=rpn-11 PE=1 SV=1
13	Q08CL9	2.9	30.0	667	0.136	0.028	Q08CL9_DANRE Im:7162391 OS=Danio rerio OX=7955 GN=im:7162391 PE=2 SV=1
14	Q5XF90	3.0	30.0	1193	0.129	0.015	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
15	P77338	3.8	29.6	1120	0.136	0.017	MSCK_ECOLI Mechanosensitive channel MscK OS=Escherichia coli (strain K12) OX=83333 GN=mscK PE=1 SV=1
16	Q6FS27	5.6	28.9	262	0.107	0.057	Q6FS27_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=YCP4 PE=3 SV=1
17	Q8GZ17	7.4	28.9	661	0.186	0.039	COBL7_ARATH COBRA-like protein 7 OS=Arabidopsis thaliana OX=3702 GN=COBL7 PE=2 SV=2
18	Q9V3H2	9.1	28.5	308	0.214	0.097	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
19	A3KNN5	9.4	28.5	310	0.207	0.094	A3KNN5_DANRE 26S proteasome non-ATPase regulatory subunit 14 OS=Danio rerio OX=7955 GN=zgc:162272 PE=1 SV=1
20	Q9FKB3	9.6	28.5	310	0.136	0.061	PANC_ARATH Pantoate--beta-alanine ligase OS=Arabidopsis thaliana OX=3702 GN=At5g48840 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15027 DUF4525	1.9e-74	259.3	Domain of unknown function (DUF4525)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304355

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438264	0.819	Leucine rich repeat, Ig-like and transmembrane domains 2
2	9606.ENSP00000373808	0.785	Soluble lamin-associated protein of 75 kDa
3	9606.ENSP00000280190	0.772	WD repeat-containing protein 17
4	9606.ENSP00000481185	0.717	Grifin
5	9606.ENSP00000375756	0.676	ATP-sensitive inward rectifier potassium channel 14
6	9606.ENSP00000284690	0.650	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
7	9606.ENSP00000301190	0.618	Photoreceptor ankyrin repeat protein
8	9606.ENSP00000367748	0.563	Chronic lymphocytic leukemia up-regulated 1 opposite strand
9	9606.ENSP00000353739	0.543	protein-L-isoaspartate O-methyltransferase domain containing 1
10	9606.ENSP00000361177	0.537	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1
11	9606.ENSP00000287590	0.521	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
12	9606.ENSP00000329794	0.513	Transcription elongation factor A protein-like 7
13	9606.ENSP00000353245	0.510	Protein LIAT1
14	9606.ENSP00000406318	0.505	Zinc finger protein 880
15	9606.ENSP00000368917	0.500	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.912	catalytic activity
GO:0140096	0.813	catalytic activity, acting on a protein
GO:0016740	0.656	transferase activity
GO:0016757	0.643	glycosyltransferase activity
GO:0008194	0.542	UDP-glycosyltransferase activity
GO:0016758	0.378	hexosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.960	cellular process
GO:0008152	0.343	metabolic process
GO:0071704	0.310	organic substance metabolic process
GO:0050896	0.304	response to stimulus
GO:0044237	0.303	cellular metabolic process
GO:0044238	0.302	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005737	0.890	cytoplasm
GO:0012505	0.814	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.656	Transferases.
EC:2.4.-.-	0.643	Glycosyltransferases.
EC:2.4.1.-	0.378	Hexosyltransferases.

[back to server]