StarFunc result for job id Q96EH3

User Input

>input (234 residues)
MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRG
LHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRY
TDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLM
LPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EH3	1.000	1.000	2.618E-41	234	1.000	1.000	Q96EH3.pdb.gz	MASU1_HUMAN Mitochondrial assembly of ribosomal large subunit protein 1 OS=Homo sapiens OX=9606 GN=MALSU1 PE=1 SV=1
2	PDB:7o9ku	0.508	0.879	7.917E-23	133	0.568	1.000	7o9ku.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
3	AFDB:Q9CAF9	0.439	0.553	4.299E-10	184	0.137	0.174	Q9CAF9.pdb.gz	IOJAM_ARATH Protein Iojap-related, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g67620 PE=2 SV=1
4	PDB:7bl36	0.378	0.831	1.825E-7	102	0.137	0.314	7bl36.pdb.gz	Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.
5	PDB:6yxyEI	0.382	0.327	2.345E-7	275	0.107	0.091	6yxyEI.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
6	PDB:4wcwD	0.347	0.657	2.106E-6	117	0.103	0.205	4wcwD.pdb.gz	Structure of Ribosomal Silencing Factor Bound to Mycobacterium tuberculosis Ribosome.
7	PDB:4atbA	0.214	0.166	4.512E-2	334	0.056	0.039	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
8	PDB:2q0cB	0.225	0.183	1.311E-1	311	0.073	0.055	2q0cB.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
9	PDB:3c66A	0.194	0.104	1.684E-1	529	0.047	0.021	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
10	PDB:4ud5B	0.268	0.199	1.793E-1	342	0.056	0.038	4ud5B.pdb.gz
11	PDB:4x4wA	0.197	0.125	1.909E-1	398	0.038	0.023	4x4wA.pdb.gz
12	PDB:4cy4E	0.174	0.138	3.358E-1	317	0.043	0.032	4cy4E.pdb.gz
13	AFDB:Q9C5C5	0.138	0.151	5.732E-1	204	0.103	0.118	Q9C5C5.pdb.gz	TRL4_ARATH Thioredoxin-like 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g07700 PE=2 SV=1
14	AFDB:Q8L9A0	0.125	0.112	1.295	270	0.081	0.070	Q8L9A0.pdb.gz	RM21_ARATH Large ribosomal subunit protein bL21m OS=Arabidopsis thaliana OX=3702 GN=RPL21M PE=1 SV=1
15	AFDB:Q08236	0.170	0.048	2.278	1176	0.128	0.026	Q08236.pdb.gz	AVO1_YEAST Target of rapamycin complex 2 subunit AVO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVO1 PE=1 SV=1
16	AFDB:Q9FLP3	0.103	0.083	2.278	302	0.085	0.066	Q9FLP3.pdb.gz	MGE1_ARATH GrpE protein homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge1 PE=2 SV=1
17	AFDB:D3YWZ9	0.125	0.105	2.425	323	0.077	0.056	D3YWZ9.pdb.gz	D3YWZ9_MOUSE RAS protein activator like 2 (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
18	AFDB:P53091	0.115	0.040	2.425	1017	0.115	0.027	P53091.pdb.gz	MCM6_YEAST DNA replication licensing factor MCM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCM6 PE=1 SV=2
19	AFDB:Q99608	0.122	0.095	2.582	321	0.115	0.084	Q99608.pdb.gz	NECD_HUMAN Necdin OS=Homo sapiens OX=9606 GN=NDN PE=1 SV=1
20	AFDB:Q1L982	0.095	0.062	2.927	406	0.107	0.062	Q1L982.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EH3	1.50e-176	486	234	1.000	1.000	MASU1_HUMAN Mitochondrial assembly of ribosomal large subunit protein 1 OS=Homo sapiens OX=9606 GN=MALSU1 PE=1 SV=1
2	P0AAT6	6.53e-15	70.5	105	0.141	0.314	IOJAP_ECOLI Ribosomal silencing factor RsfS OS=Escherichia coli (strain K12) OX=83333 GN=rsfS PE=1 SV=1
3	Q97P97	3.79e-10	57.8	117	0.141	0.282	IOJAP_STRPN Ribosomal silencing factor RsfS OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=rsfS PE=1 SV=1
4	O86327	6.45e-07	49.3	126	0.107	0.198	O86327_MYCTU Ribosomal silencing factor RsfS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rsfS PE=1 SV=1
5	Q9LDY9	5.15e-06	48.1	238	0.120	0.118	IOJAP_ARATH Protein Iojap, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IJ PE=2 SV=1
6	Q584Y2	6.42e-06	48.5	349	0.145	0.097	Q584Y2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.480 PE=1 SV=1
7	Q9CAF9	8.50e-06	47.0	184	0.128	0.163	IOJAM_ARATH Protein Iojap-related, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g67620 PE=2 SV=1
8	Q9LFS2	2.6	31.6	641	0.132	0.048	GEX3_ARATH Protein GAMETE EXPRESSED 3 OS=Arabidopsis thaliana OX=3702 GN=GEX3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02410 RsfS	6.1e-24	95.7	Ribosomal silencing factor during starvation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419370

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253099	0.974	Mitochondrial ribosomal protein L4
2	9606.ENSP00000223324	0.966	Mitochondrial ribosomal protein L32
3	9606.ENSP00000377486	0.963	Mitochondrial ribosomal protein L19
4	9606.ENSP00000301585	0.960	Peptidyl-tRNA hydrolase ICT1, mitochondrial
5	9606.ENSP00000305682	0.955	Mitochondrial ribosomal protein L39
6	9606.ENSP00000354086	0.953	Mitochondrial ribosomal protein L37
7	9606.ENSP00000361206	0.951	Mitochondrial ribosomal protein S18A
8	9606.ENSP00000341082	0.950	Mitochondrial ribosomal protein L20
9	9606.ENSP00000361084	0.949	39S ribosomal protein L14, mitochondrial
10	9606.ENSP00000424328	0.949	Mitochondrial ribosomal protein S30
11	9606.ENSP00000417602	0.947	Belongs to the universal ribosomal protein uL29 family.
12	9606.ENSP00000199706	0.933	Mitochondrial ribosomal protein L28
13	9606.ENSP00000225969	0.924	Mitochondrial ribosomal protein L27
14	9606.ENSP00000308897	0.924	Mitochondrial ribosomal protein L11
15	9606.ENSP00000360498	0.923	39S ribosomal protein L41, mitochondrial
16	9606.ENSP00000354580	0.920	Mitochondrial ribosomal protein L21
17	9606.ENSP00000258383	0.919	39S ribosomal protein L44, mitochondrial
18	9606.ENSP00000423399	0.910	Mitochondrial ribosomal protein L36
19	9606.ENSP00000449884	0.908	Mitochondrial ribosomal protein L42
20	9606.ENSP00000338389	0.895	Mitochondrial ribosomal protein L35

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071840	0.975	cellular component organization or biogenesis
GO:0044085	0.964	cellular component biogenesis
GO:0031323	0.961	regulation of cellular metabolic process
GO:0042254	0.947	ribosome biogenesis
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0080090	0.935	regulation of primary metabolic process
GO:0006417	0.927	regulation of translation
GO:0062125	0.897	regulation of mitochondrial gene expression
GO:0070129	0.834	regulation of mitochondrial translation
GO:0042273	0.783	ribosomal large subunit biogenesis
GO:0034249	0.769	negative regulation of amide metabolic process
GO:0048523	0.737	negative regulation of cellular process
GO:0031327	0.724	negative regulation of cellular biosynthetic process
GO:0010605	0.717	negative regulation of macromolecule metabolic process
GO:0017148	0.702	negative regulation of translation
GO:0008152	0.576	metabolic process
GO:0071704	0.424	organic substance metabolic process
GO:0044238	0.381	primary metabolic process
GO:0006807	0.352	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005762	0.997	mitochondrial large ribosomal subunit
GO:0016020	0.941	membrane
GO:0031966	0.915	mitochondrial membrane
GO:0005743	0.913	mitochondrial inner membrane
GO:0031981	0.502	nuclear lumen
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]