StarFunc result for job id Q96EK9

User Input

>input (354 residues)
MPLVVFCGLPYSGKSRRAEELRVALAAEGRAVYVVDDAAVLGAEDPAVYGDSAREKALRG
ALRASVERRLSRHDVVILDSLNYIKGFRYELYCLARAARTPLCLVYCVRPGGPIAGPQVA
GANENPGRNVSVSWRPRAEEDGRAQAAGSSVLRELHTADSVVNGSAQADVPKELEREESG
AAESPALVTPDSEKSAKHGSGAFYSPELLEALTLRFEAPDSRNRWDRPLFTLVGLEEPLP
LAGIRSALFENRAPPPHQSTQSQPLASGSFLHQLDQVTSQVLAGLMEAQKSAVPGDLLTL
PGTTEHLRFTRPLTMAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLSQSLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EK9	1.000	1.000	2.667E-62	354	1.000	1.000	Q96EK9.pdb.gz	KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1
2	AFDB:Q9P7V4	0.456	0.569	9.754E-21	281	0.260	0.327	Q9P7V4.pdb.gz	KTI12_SCHPO Protein kti12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kti12 PE=3 SV=1
3	AFDB:P34253	0.460	0.517	7.372E-20	313	0.251	0.284	P34253.pdb.gz	KTI12_YEAST Protein KTI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTI12 PE=1 SV=2
4	AFDB:Q9LMH0	0.462	0.520	1.314E-19	302	0.271	0.318	Q9LMH0.pdb.gz	KTI12_ARATH Protein KTI12 homolog OS=Arabidopsis thaliana OX=3702 GN=KTI12 PE=1 SV=1
5	AFDB:B9GAG9	0.447	0.521	4.212E-18	301	0.271	0.319	B9GAG9.pdb.gz	KTI12_ORYSJ Protein KTI12 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=KTI12 PE=3 SV=1
6	PDB:5htkA	0.278	0.234	4.876E-5	425	0.056	0.047	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
7	PDB:2axnA	0.284	0.226	5.473E-5	451	0.056	0.044	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
8	PDB:1k6mA	0.277	0.229	1.952E-4	432	0.056	0.046	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
9	AFDB:P0A6J1	0.261	0.445	2.130E-4	201	0.065	0.114	P0A6J1.pdb.gz	CYSC_ECOLI Adenylyl-sulfate kinase OS=Escherichia coli (strain K12) OX=83333 GN=cysC PE=1 SV=2
10	PDB:1bifA	0.275	0.227	2.191E-4	432	0.059	0.049	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
11	AFDB:Q02196	0.284	0.482	2.683E-4	202	0.045	0.079	Q02196.pdb.gz	KAPS_YEAST Adenylyl-sulfate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET14 PE=1 SV=1
12	PDB:1m7gC	0.262	0.427	3.283E-4	209	0.059	0.100	1m7gC.pdb.gz	Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
13	AFDB:P9WNM5	0.276	0.163	4.021E-4	614	0.062	0.036	P9WNM5.pdb.gz	CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cysNC PE=1 SV=1
14	PDB:2iyvA	0.224	0.390	5.523E-4	179	0.096	0.190	2iyvA.pdb.gz	Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
15	AFDB:Q92203	0.266	0.441	8.046E-4	206	0.059	0.102	Q92203.pdb.gz	KAPS_EMENI Adenylyl-sulfate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sD PE=3 SV=2
16	AFDB:Q27128	0.284	0.168	9.031E-4	610	0.054	0.031	Q27128.pdb.gz	PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo OX=6431 PE=1 SV=1
17	PDB:1xjqB	0.274	0.167	9.844E-4	590	0.048	0.029	1xjqB.pdb.gz	The crystal structure of human PAPS synthetase 1 reveals asymmetry in substrate binding
18	PDB:1e2fA	0.195	0.308	1.970E-3	210	0.051	0.086	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
19	PDB:1ko5A	0.322	0.601	2.952E-3	172	0.093	0.192	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
20	PDB:5gadi	0.207	0.168	4.423E-3	450	0.059	0.047	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EK9	0.0	717	354	1.000	1.000	KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1
2	Q9LMH0	5.08e-25	105	302	0.263	0.308	KTI12_ARATH Protein KTI12 homolog OS=Arabidopsis thaliana OX=3702 GN=KTI12 PE=1 SV=1
3	B9GAG9	8.46e-22	96.3	301	0.271	0.319	KTI12_ORYSJ Protein KTI12 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=KTI12 PE=3 SV=1
4	Q9P7V4	7.10e-20	90.5	281	0.130	0.164	KTI12_SCHPO Protein kti12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kti12 PE=3 SV=1
5	P34253	2.14e-16	80.9	313	0.119	0.134	KTI12_YEAST Protein KTI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTI12 PE=1 SV=2
6	P40387	6.9	31.2	513	0.045	0.031	TPS1_SCHPO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
7	Q554U9	7.3	31.2	527	0.051	0.034	EIF3D_DICDI Eukaryotic translation initiation factor 3 subunit D OS=Dictyostelium discoideum OX=44689 GN=eif3d PE=3 SV=1
8	O13809	7.5	30.8	266	0.031	0.041	YE0C_SCHPO Uncharacterized FAD-binding protein C17H9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.12c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13671 AAA_33	0.13	23.9	AAA domain
2	PF01583 APS_kinase	3.5e+02	12.5	Adenylylsulphate kinase
3	PF08433 KTI12	1.3e-105	364.3	Chromatin associated protein KTI12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360676

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256398	0.985	Elongator complex protein 3
2	9606.ENSP00000363779	0.970	Elongator complex protein 1
3	9606.ENSP00000414851	0.968	Elongator complex protein 2
4	9606.ENSP00000379267	0.930	Elongator complex protein 4
5	9606.ENSP00000419599	0.850	DPH3 homolog
6	9606.ENSP00000244051	0.849	Adenylyltransferase and sulfurtransferase MOCS3
7	9606.ENSP00000390011	0.845	Cytoplasmic tRNA 2-thiolation protein 1
8	9606.ENSP00000412922	0.814	Ubiquitin-related modifier 1
9	9606.ENSP00000388320	0.766	Cytoplasmic tRNA 2-thiolation protein 2
10	9606.ENSP00000296149	0.750	Elongator complex protein 6
11	9606.ENSP00000343515	0.742	Transcription elongation factor A protein 2
12	9606.ENSP00000428426	0.742	Transcription elongation factor A protein 1
13	9606.ENSP00000397673	0.737	Alkylated DNA repair protein alkB homolog 8
14	9606.ENSP00000478417	0.725	Serine/threonine-protein phosphatase 6 regulatory subunit 2
15	9606.ENSP00000414202	0.716	Serine/threonine-protein phosphatase 6 regulatory subunit 1
16	9606.ENSP00000377390	0.695	Serine/threonine-protein phosphatase 6 regulatory subunit 3
17	9606.ENSP00000379869	0.682	Elongator complex protein 5
18	9606.ENSP00000411788	0.663	G-protein coupled receptor 35
19	9606.ENSP00000438349	0.643	Multifunctional methyltransferase subunit TRM112-like protein
20	9606.ENSP00000326948	0.600	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.338	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0044238	0.995	primary metabolic process
GO:0034660	0.994	ncRNA metabolic process
GO:0006396	0.994	RNA processing
GO:0050789	0.978	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0034470	0.956	ncRNA processing
GO:0043412	0.921	macromolecule modification
GO:0051171	0.905	regulation of nitrogen compound metabolic process
GO:0031323	0.899	regulation of cellular metabolic process
GO:0080090	0.898	regulation of primary metabolic process
GO:0010468	0.896	regulation of gene expression
GO:0008033	0.893	tRNA processing
GO:0006400	0.849	tRNA modification
GO:0019219	0.768	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.649	regulation of macromolecule biosynthetic process
GO:0031326	0.645	regulation of cellular biosynthetic process
GO:0051252	0.619	regulation of RNA metabolic process
GO:0006355	0.529	regulation of DNA-templated transcription
GO:0006357	0.449	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005737	0.977	cytoplasm
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0005829	0.972	cytosol
GO:0070013	0.958	intracellular organelle lumen
GO:0005634	0.954	nucleus
GO:0032991	0.936	protein-containing complex
GO:0031981	0.893	nuclear lumen
GO:0005654	0.881	nucleoplasm
GO:0016020	0.791	membrane
GO:1902494	0.707	catalytic complex
GO:0140535	0.471	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]