StarFunc result for job id Q96EM0

User Input

>input (354 residues)
MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDH
VRRRLMFEPRGHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGL
VPAPPAGTREARVNIHCPCGLVTAFVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGK
VMVDIAYGGAFYAFVTAEKLGLDICSAKTRDLVDAASAVTEAVKAQFKINHPDSEDLAFL
YGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKS
SATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EM0	1.000	1.000	5.908E-79	354	1.000	1.000	Q96EM0.pdb.gz	T3HPD_HUMAN Trans-3-hydroxy-L-proline dehydratase OS=Homo sapiens OX=9606 GN=L3HYPDH PE=1 SV=2
2	AFDB:Q9CXA2	0.989	0.989	7.031E-73	354	0.890	0.890	Q9CXA2.pdb.gz	T3HPD_MOUSE Trans-L-3-hydroxyproline dehydratase OS=Mus musculus OX=10090 GN=L3hypdh PE=1 SV=1
3	PDB:7qpoB	0.886	0.928	1.020E-65	337	0.952	1.000	7qpoB.pdb.gz
4	AFDB:P0DKB4	0.908	0.985	1.990E-53	326	0.559	0.607	P0DKB4.pdb.gz	T3HPD_SACKO Trans-L-3-hydroxyproline dehydratase OS=Saccoglossus kowalevskii OX=10224 GN=l3hypdh PE=1 SV=1
5	AFDB:Q0B950	0.901	0.951	1.993E-46	335	0.415	0.439	Q0B950.pdb.gz	T3HPD_BURCM Trans-3-hydroxy-L-proline dehydratase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=Bamb_3769 PE=1 SV=1
6	AFDB:D2AV87	0.898	0.954	1.994E-42	333	0.322	0.342	D2AV87.pdb.gz	4HYPE_STRRD 4-hydroxyproline 2-epimerase OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) OX=479432 GN=Sros_6004 PE=1 SV=1
7	AFDB:Q6HMS9	0.883	0.935	3.757E-42	334	0.339	0.359	Q6HMS9.pdb.gz	T3HPD_BACHK Trans-3-hydroxy-L-proline dehydratase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=prdF PE=1 SV=1
8	AFDB:A3QFI1	0.867	0.920	4.470E-37	333	0.285	0.303	A3QFI1.pdb.gz	4HYPE_SHELP 4-hydroxyproline 2-epimerase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=Shew_2363 PE=1 SV=1
9	AFDB:A1BBM5	0.870	0.920	4.735E-37	334	0.302	0.320	A1BBM5.pdb.gz	4HYPE_PARDP 4-hydroxyproline 2-epimerase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=hypF PE=1 SV=1
10	AFDB:Q9I489	0.890	0.916	5.016E-37	344	0.260	0.267	Q9I489.pdb.gz	T3HPD_PSEAE Bifunctional trans-3-hydroxy-L-proline dehydratase/2-epimerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lhpL PE=1 SV=1
11	AFDB:Q92WR9	0.892	0.923	6.314E-37	342	0.246	0.254	Q92WR9.pdb.gz	T3HPD_RHIME Trans-3-hydroxy-L-proline dehydratase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=RB0260 PE=1 SV=1
12	PDB:4k7gD	0.892	0.897	1.627E-36	352	0.237	0.239	4k7gD.pdb.gz	Crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site
13	PDB:4juuA	0.729	0.811	2.581E-32	315	0.280	0.314	4juuA.pdb.gz
14	PDB:4jd7A	0.721	0.802	2.734E-32	314	0.282	0.318	4jd7A.pdb.gz
15	PDB:2azpA	0.812	0.899	1.828E-30	318	0.271	0.302	2azpA.pdb.gz
16	PDB:5k87A	0.629	0.579	4.880E-15	389	0.169	0.154	5k87A.pdb.gz	The PrpF protein of Shewanella oneidensis MR-1 catalyzes the isomerization of 2-methyl-cis-aconitate during the catabolism of propionate via the AcnD-dependent 2-methylcitric acid cycle.
17	PDB:3g7kB	0.494	0.460	1.457E-14	387	0.192	0.176	3g7kB.pdb.gz
18	PDB:7vdyA	0.597	0.724	2.447E-13	285	0.141	0.175	7vdyA.pdb.gz
19	PDB:2pw0B	0.547	0.565	7.305E-13	341	0.175	0.182	2pw0B.pdb.gz	The three-dimensional crystal structure of the PrpF protein of Shewanella oneidensis complexed with trans-aconitate: insights into its biological function.
20	PDB:4ijzB	0.524	0.646	5.479E-12	275	0.136	0.175	4ijzB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EM0	0.0	721	354	1.000	1.000	T3HPD_HUMAN Trans-3-hydroxy-L-proline dehydratase OS=Homo sapiens OX=9606 GN=L3HYPDH PE=1 SV=2
2	Q9CXA2	0.0	651	354	0.890	0.890	T3HPD_MOUSE Trans-L-3-hydroxyproline dehydratase OS=Mus musculus OX=10090 GN=L3hypdh PE=1 SV=1
3	P0DKB4	2.48e-145	415	326	0.565	0.613	T3HPD_SACKO Trans-L-3-hydroxyproline dehydratase OS=Saccoglossus kowalevskii OX=10224 GN=l3hypdh PE=1 SV=1
4	Q0B950	1.76e-92	281	335	0.415	0.439	T3HPD_BURCM Trans-3-hydroxy-L-proline dehydratase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=Bamb_3769 PE=1 SV=1
5	Q6HMS9	6.28e-70	223	334	0.347	0.368	T3HPD_BACHK Trans-3-hydroxy-L-proline dehydratase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=prdF PE=1 SV=1
6	Q2YLF3	5.77e-58	192	333	0.328	0.348	4HYPE_BRUA2 4-hydroxyproline epimerase OS=Brucella abortus (strain 2308) OX=359391 GN=prpA PE=1 SV=1
7	Q9L4Q3	6.08e-57	189	299	0.291	0.344	Q9L4Q3_ACEST Proline racemase OS=Acetoanaerobium sticklandii OX=1511 GN=prdF PE=3 SV=1
8	D2AV87	2.68e-56	188	333	0.336	0.357	4HYPE_STRRD 4-hydroxyproline 2-epimerase OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) OX=479432 GN=Sros_6004 PE=1 SV=1
9	A6WXX7	8.16e-55	184	337	0.328	0.344	4HPE2_BRUA4 4-hydroxyproline 2-epimerase 2 OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=Oant_1111 PE=1 SV=1
10	A1BBM5	1.28e-51	176	334	0.311	0.329	4HYPE_PARDP 4-hydroxyproline 2-epimerase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=hypF PE=1 SV=1
11	A3QFI1	5.77e-48	166	333	0.305	0.324	4HYPE_SHELP 4-hydroxyproline 2-epimerase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=Shew_2363 PE=1 SV=1
12	A9AQW9	2.41e-45	160	338	0.311	0.325	4HPE2_BURM1 4-hydroxyproline 2-epimerase 2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=prdF PE=1 SV=1
13	A5VZY6	1.47e-37	139	308	0.299	0.344	4HYPE_PSEP1 4-hydroxyproline 2-epimerase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=Pput_1285 PE=1 SV=1
14	Q8P833	9.79e-37	136	312	0.294	0.333	4HYPE_XANCP 4-hydroxyproline 2-epimerase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC2415 PE=1 SV=1
15	Q9I489	4.53e-36	135	344	0.274	0.282	T3HPD_PSEAE Bifunctional trans-3-hydroxy-L-proline dehydratase/2-epimerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lhpL PE=1 SV=1
16	Q92WR9	7.91e-35	132	342	0.266	0.275	T3HPD_RHIME Trans-3-hydroxy-L-proline dehydratase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=RB0260 PE=1 SV=1
17	A9CH01	1.57e-34	131	342	0.260	0.269	3HD4E_AGRFC Trans-3-hydroxy-L-proline dehydratase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu4684 PE=1 SV=1
18	A0NXQ9	1.58e-33	129	341	0.271	0.282	T3HPD_ROSAI Trans-3-hydroxy-L-proline dehydratase OS=Roseibium aggregatum (strain ATCC 25650 / DSM 13394 / JCM 20685 / NBRC 16684 / NCIMB 2208 / IAM 12614 / B1) OX=384765 GN=SIAM614_28502 PE=1 SV=1
19	Q8G2I3	2.47e-33	128	342	0.254	0.263	T3HPD_BRUSU Trans-3-hydroxy-L-proline dehydratase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=BR0337 PE=1 SV=1
20	Q9I476	6.53e-33	126	314	0.291	0.328	4HYPE_PSEAE 4-hydroxyproline 2-epimerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1268 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02567 PhzC-PhzF	4.9e+02	11.6	Phenazine biosynthesis-like protein
2	PF05544 Pro_racemase	1.1e-120	414.3	Proline racemase
3	PF02788 RuBisCO_large_N	4.7e+02	12.4	Ribulose bisphosphate carboxylase large chain, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247194

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228476	0.941	D-amino-acid oxidase
2	9606.ENSP00000219599	0.682	Ketimine reductase mu-crystallin
3	9606.ENSP00000352941	0.614	BTB/POZ domain-containing protein KCTD18
4	9606.ENSP00000480322	0.579	CD99 antigen-like protein 2
5	9606.ENSP00000377725	0.561	Zinc finger protein with KRAB and SCAN domains 5
6	9606.ENSP00000382814	0.553	Protein FAM234A
7	9606.ENSP00000232501	0.552	GATOR complex protein NPRL2
8	9606.ENSP00000362105	0.546	Probable U3 small nucleolar RNA-associated protein 11
9	9606.ENSP00000361502	0.536	Putative hydroxypyruvate isomerase
10	9606.ENSP00000256257	0.526	RING finger protein 122
11	9606.ENSP00000343190	0.523	Phosphopantothenoylcysteine decarboxylase
12	9606.ENSP00000359680	0.515	4-hydroxy-2-oxoglutarate aldolase, mitochondrial
13	9606.ENSP00000428223	0.511	Ribosomal protein L26 like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016836	1.000	hydro-lyase activity
GO:0016853	0.332	isomerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0008152	0.921	metabolic process
GO:0044237	0.902	cellular metabolic process
GO:0071704	0.865	organic substance metabolic process
GO:0009056	0.685	catabolic process
GO:0006807	0.677	nitrogen compound metabolic process
GO:0065007	0.646	biological regulation
GO:1901575	0.646	organic substance catabolic process
GO:0044248	0.515	cellular catabolic process
GO:0050789	0.433	regulation of biological process
GO:0044281	0.327	small molecule metabolic process
GO:0050794	0.314	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043227	0.993	membrane-bounded organelle
GO:0043231	0.926	intracellular membrane-bounded organelle
GO:0005829	0.840	cytosol
GO:0005576	0.709	extracellular region
GO:0005615	0.659	extracellular space
GO:0070013	0.485	intracellular organelle lumen
GO:0070062	0.398	extracellular exosome
GO:0005634	0.344	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	1.000	Hydro-lyases.
EC:5.-.-.-	0.332	Isomerases.

[back to server]