StarFunc result for job id Q96EN8

User Input

>input (888 residues)
MAGAAAESGRELWTFAGSRDPSAPRLAYGYGPGSLRELRAREFSRLAGTVYLDHAGATLF
SQSQLESFTSDLMENTYGNPHSQNISSKLTHDTVEQVRYRILAHFHTTAEDYTVIFTAGS
TAALKLVAEAFPWVSQGPESSGSRFCYLTDSHTSVVGMRNVTMAINVISTPVRPEDLWSA
EERSASASNPDCQLPHLFCYPAQSNFSGVRYPLSWIEEVKSGRLHPVSTPGKWFVLLDAA
SYVSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLA
GEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVAL
SSLQYPNGAPVVRIYSDSEFSSPEVQGPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRT
GCFCNTGACQRHLGISNEMVRKHFQAGHVCGDNMDLIDGQPTGSVRISFGYMSTLDDVQA
FLRFIIDTRLHSSGDWPVPQAHADTGETGAPSADSQADVIPAVMGRRSLSPQEDALTGSR
VWNNSSTVNAVPVAPPVCDVARTQPTPSEKAAGVLEGALGPHVVTNLYLYPIKSCAAFEV
TRWPVGNQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEV
PLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKKHG
KDQLPGTMATLSLVNEAQYLLINTSSILELHRQLNTSDENGKEELFSLKDLSLRFRANII
INGKRAFEEEKWDEISIGSLRFQVLGPCHRCQMICIDQQTGQRNQHVFQKLSESRETKVN
FGMYLMHASLDLSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EN8	1.000	1.000	0.000	888	1.000	1.000	Q96EN8.pdb.gz	MOCOS_HUMAN Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2
2	AFDB:Q9N0E7	0.883	0.889	0.000	882	0.786	0.791	Q9N0E7.pdb.gz	MOCOS_BOVIN Molybdenum cofactor sulfurase OS=Bos taurus OX=9913 GN=MOCOS PE=2 SV=3
3	AFDB:Q9VRA2	0.492	0.558	6.762E-85	781	0.350	0.398	Q9VRA2.pdb.gz	MOCOS_DROME Molybdenum cofactor sulfurase OS=Drosophila melanogaster OX=7227 GN=mal PE=1 SV=1
4	AFDB:Q9C5X8	0.609	0.654	3.623E-81	819	0.349	0.379	Q9C5X8.pdb.gz	MOCOS_ARATH Molybdenum cofactor sulfurase OS=Arabidopsis thaliana OX=3702 GN=ABA3 PE=1 SV=1
5	PDB:4q75A	0.390	0.805	1.581E-23	413	0.123	0.264	4q75A.pdb.gz
6	AFDB:P9WQ69	0.400	0.823	3.258E-23	417	0.098	0.209	P9WQ69.pdb.gz	CSD_MYCTU Probable cysteine desulfurase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=csd PE=1 SV=1
7	PDB:6o11A	0.382	0.808	3.381E-22	406	0.106	0.232	6o11A.pdb.gz	Direct observation of intermediates in the SufS cysteine desulfurase reaction reveals functional roles of conserved active-site residues.
8	PDB:7cepA	0.402	0.833	5.237E-22	414	0.098	0.210	7cepA.pdb.gz	Cycloserine enantiomers inhibit PLP-dependent cysteine desulfurase SufS via distinct mechanisms.
9	PDB:5ft8A	0.384	0.810	6.518E-22	401	0.100	0.222	5ft8A.pdb.gz	Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
10	PDB:6fw2A	0.279	0.546	4.616E-19	444	0.081	0.162	6fw2A.pdb.gz	Crystal structure of human mARC1 reveals its exceptional position among eukaryotic molybdenum enzymes.
11	PDB:3caiA	0.362	0.763	5.093E-17	396	0.078	0.174	3caiA.pdb.gz
12	PDB:3lvmB	0.363	0.779	6.001E-17	394	0.086	0.193	3lvmB.pdb.gz	Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions.
13	PDB:5wt6A	0.327	0.754	1.792E-16	366	0.081	0.197	5wt6A.pdb.gz	Structural snapshot of cysteine desulfurase NifS with L-cysteine in initiation of catalysis
14	PDB:3a9yA	0.354	0.734	7.844E-16	403	0.100	0.221	3a9yA.pdb.gz	Reaction mechanism and molecular basis for selenium/sulfur discrimination of selenocysteine lyase.
15	PDB:5hh9A	0.365	0.783	2.473E-15	390	0.064	0.146	5hh9A.pdb.gz	Structural and Biochemical Characterization of a Novel L-Cystine Desulfurase involved in the biosynthesis of the major siderophore pyoverdine in Pseudomonas aeruginosa
16	AFDB:P16453	0.296	0.386	5.872E-11	656	0.092	0.125	P16453.pdb.gz	DCHS_RAT Histidine decarboxylase OS=Rattus norvegicus OX=10116 GN=Hdc PE=2 SV=2
17	AFDB:A0A068Q816	0.302	0.389	2.852E-9	664	0.096	0.128	A0A068Q816.pdb.gz	A0A068Q816_CHICK Histidine decarboxylase OS=Gallus gallus OX=9031 GN=HDC PE=2 SV=1
18	AFDB:Q99NH2	0.052	0.042	2.896E-2	1333	0.070	0.047	Q99NH2.pdb.gz	PARD3_MOUSE Partitioning defective 3 homolog OS=Mus musculus OX=10090 GN=Pard3 PE=1 SV=2
19	AFDB:A0A1P8BC43	0.064	0.079	3.413E-2	689	0.047	0.061	A0A1P8BC43.pdb.gz	A0A1P8BC43_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MCL19.25 PE=1 SV=1
20	AFDB:Q5TIQ4	0.048	0.046	6.229E-2	938	0.047	0.045	Q5TIQ4.pdb.gz	Q5TIQ4_ACETH 1,4-beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=celY PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EN8	0.0	1853	888	1.000	1.000	MOCOS_HUMAN Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2
2	Q9N0E7	0.0	1425	882	0.785	0.790	MOCOS_BOVIN Molybdenum cofactor sulfurase OS=Bos taurus OX=9913 GN=MOCOS PE=2 SV=3
3	Q9C5X8	1.69e-174	528	819	0.350	0.380	MOCOS_ARATH Molybdenum cofactor sulfurase OS=Arabidopsis thaliana OX=3702 GN=ABA3 PE=1 SV=1
4	Q9VRA2	1.68e-168	511	781	0.358	0.407	MOCOS_DROME Molybdenum cofactor sulfurase OS=Drosophila melanogaster OX=7227 GN=mal PE=1 SV=1
5	Q922Q1	8.64e-24	105	338	0.079	0.207	MARC2_MOUSE Mitochondrial amidoxime reducing component 2 OS=Mus musculus OX=10090 GN=Mtarc2 PE=1 SV=1
6	O48588	5.46e-23	102	308	0.075	0.218	O48588_ARATH Molybdenum cofactor sulfurase family protein OS=Arabidopsis thaliana OX=3702 GN=T19K24.17 PE=1 SV=1
7	Q969Z3	4.06e-22	100	335	0.072	0.191	MARC2_HUMAN Mitochondrial amidoxime reducing component 2 OS=Homo sapiens OX=9606 GN=MTARC2 PE=1 SV=1
8	Q5VT66	1.72e-20	95.9	337	0.070	0.184	MARC1_HUMAN Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MTARC1 PE=1 SV=1
9	Q9CW42	7.20e-20	94.4	340	0.074	0.194	MARC1_MOUSE Mitochondrial amidoxime-reducing component 1 OS=Mus musculus OX=10090 GN=Mtarc1 PE=1 SV=2
10	O45394	3.68e-15	80.1	339	0.077	0.201	O45394_CAEEL MOSC domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F22B8.7 PE=1 SV=2
11	P75863	6.91e-14	76.6	369	0.063	0.152	YCBX_ECOLI Uncharacterized protein YcbX OS=Escherichia coli (strain K12) OX=83333 GN=ycbX PE=1 SV=1
12	Q9FGD5	2.31e-12	73.6	870	0.080	0.082	Q9FGD5_ARATH Emb
13	H7BYZ9	6.56e-11	66.2	263	0.055	0.186	H7BYZ9_HUMAN Mitochondrial amidoxime reducing component 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTARC1 PE=1 SV=1
14	Q93WX6	2.27e-09	63.2	463	0.132	0.253	CNIF1_ARATH Cysteine desulfurase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NFS2 PE=1 SV=1
15	Q9Y697	5.03e-08	58.9	457	0.073	0.142	NFS1_HUMAN Cysteine desulfurase OS=Homo sapiens OX=9606 GN=NFS1 PE=1 SV=3
16	Q9Z1J3	1.07e-07	57.8	459	0.072	0.139	NFS1_MOUSE Cysteine desulfurase OS=Mus musculus OX=10090 GN=Nfs1 PE=1 SV=3
17	Q5QP19	1.82e-07	56.6	397	0.068	0.151	Q5QP19_HUMAN cysteine desulfurase OS=Homo sapiens OX=9606 GN=NFS1 PE=2 SV=1
18	Q9VKD3	2.28e-07	56.6	462	0.081	0.156	NFS1_DROME Cysteine desulfurase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Nfs1 PE=1 SV=1
19	P77444	1.96e-06	53.5	406	0.108	0.236	SUFS_ECOLI Cysteine desulfurase OS=Escherichia coli (strain K12) OX=83333 GN=sufS PE=1 SV=1
20	Q9EXP2	6.38e-05	48.9	412	0.105	0.226	SUFS_DICD3 Cysteine desulfurase OS=Dickeya dadantii (strain 3937) OX=198628 GN=sufS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00266 Aminotran_5	7.8e-26	102.5	Aminotransferase class-V
2	PF03473 MOSC	6e-23	92.9	MOSC domain
3	PF03476 MOSC_N	4.2e-27	105.8	MOSC N-terminal beta barrel domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363832	0.937	Aldehyde oxidase
2	9606.ENSP00000368727	0.919	Xanthine dehydrogenase/oxidase
3	9606.ENSP00000310623	0.866	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
4	9606.ENSP00000362282	0.822	Molybdenum cofactor biosynthesis protein 1
5	9606.ENSP00000344446	0.704	FYVE, RhoGEF and PH domain-containing protein 6
6	9606.ENSP00000334008	0.688	Alpha-parvin
7	9606.ENSP00000364320	0.628	mRNA turnover protein 4 homolog
8	9606.ENSP00000465517	0.604	UPF0711 protein C18orf21
9	9606.ENSP00000364295	0.600	Lysosomal amino acid transporter 1 homolog
10	9606.ENSP00000417901	0.585	Gephyrin
11	9606.ENSP00000265081	0.564	DNA mismatch repair protein Msh3
12	9606.ENSP00000382815	0.561	Uncharacterized protein KIAA2026
13	9606.ENSP00000265462	0.558	Peroxiredoxin-5, mitochondrial
14	9606.ENSP00000258662	0.547	Nucleotide triphosphate diphosphatase NUDT15
15	9606.ENSP00000333551	0.540	Pyridoxal phosphate homeostasis protein
16	9606.ENSP00000380157	0.539	Molybdopterin synthase catalytic subunit
17	9606.ENSP00000381984	0.520	Regulation of nuclear pre-mRNA domain-containing protein 1A
18	9606.ENSP00000342755	0.519	E3 ubiquitin-protein ligase NRDP1
19	9606.ENSP00000363205	0.514	Cysteine desulfurase, mitochondrial
20	9606.ENSP00000371253	0.511	Trifunctional purine biosynthetic protein adenosine-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008265	1.000	Mo-molybdopterin cofactor sulfurase activity
GO:0005515	0.998	protein binding
GO:0097159	0.343	organic cyclic compound binding
GO:1901363	0.333	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0019637	0.990	organophosphate metabolic process
GO:0006796	0.989	phosphate-containing compound metabolic process
GO:1901360	0.987	organic cyclic compound metabolic process
GO:0046483	0.983	heterocycle metabolic process
GO:0043170	0.962	macromolecule metabolic process
GO:1901564	0.956	organonitrogen compound metabolic process
GO:0019538	0.943	protein metabolic process
GO:0009058	0.623	biosynthetic process
GO:0044249	0.581	cellular biosynthetic process
GO:1901576	0.564	organic substance biosynthetic process
GO:0090407	0.362	organophosphate biosynthetic process
GO:1901362	0.334	organic cyclic compound biosynthetic process
GO:1901566	0.331	organonitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.965	membrane-bounded organelle
GO:0043231	0.953	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.1.9	1.000	molybdenum cofactor sulfurtransferase.

[back to server]