StarFunc result for job id Q96EP0

User Input

>input (1072 residues)
MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCN
AHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
HLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQR
QDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAG
QQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQ
HGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAE
LALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECT
ICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYAL
FHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
CYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAG
ARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATL
YEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q924T7	0.622	0.626	0.000	1066	0.861	0.866	Q924T7.pdb.gz	RNF31_MOUSE E3 ubiquitin-protein ligase RNF31 OS=Mus musculus OX=10090 GN=Rnf31 PE=1 SV=2
2	AFDB:Q96EP0	1.000	1.000	0.000	1072	1.000	1.000	Q96EP0.pdb.gz	RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31 PE=1 SV=1
3	PDB:5tteB	0.123	0.273	1.616E-6	442	0.054	0.131	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
4	PDB:7b5lH	0.153	0.340	2.367E-6	423	0.049	0.125	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
5	PDB:7od1A	0.099	0.211	4.847E-6	430	0.061	0.151	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
6	PDB:4kblA	0.116	0.281	6.096E-5	395	0.049	0.134	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
7	PDB:7oniH	0.096	0.219	2.412E-3	380	0.033	0.092	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
8	PDB:4zynB	0.085	0.196	2.530E-3	385	0.041	0.114	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
9	AFDB:A0A0R4IVZ0	0.041	0.032	2.522E-2	1436	0.054	0.040	A0A0R4IVZ0.pdb.gz	A0A0R4IVZ0_DANRE Nuclear pore complex protein Nup153 OS=Danio rerio OX=7955 GN=fd23d09 PE=1 SV=1
10	PDB:4ywtA	0.041	0.086	3.501E-2	411	0.048	0.124	4ywtA.pdb.gz	Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.
11	AFDB:Q5XIX0	0.048	0.070	8.733E-2	703	0.093	0.142	Q5XIX0.pdb.gz	DJC14_RAT DnaJ homolog subfamily C member 14 OS=Rattus norvegicus OX=10116 GN=Dnajc14 PE=1 SV=1
12	AFDB:Q38B13	0.064	0.082	7.145E-1	756	0.091	0.130	Q38B13.pdb.gz	Q38B13_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0990 PE=4 SV=1
13	AFDB:X1WEA3	0.044	0.045	7.495E-1	1034	0.083	0.086	X1WEA3.pdb.gz	X1WEA3_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=ulk2 PE=4 SV=1
14	PDB:3ihpB	0.042	0.063	1.091	681	0.019	0.029	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
15	AFDB:Q6NSK7	0.050	0.055	1.152	908	0.074	0.087	Q6NSK7.pdb.gz	Q6NSK7_HUMAN RIN3 protein OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=1
16	AFDB:Q9VUQ9	0.043	0.028	1.395	2139	0.084	0.042	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
17	AFDB:Q96PE2	0.052	0.034	1.609	2063	0.079	0.041	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
18	PDB:7zs9M	0.044	0.121	1.678	310	0.026	0.090	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
19	PDB:6gejS	0.032	0.133	1.846	208	0.023	0.120	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	AFDB:P23497	0.052	0.060	2.144	879	0.068	0.083	P23497.pdb.gz	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q924T7	0.0	1827	1066	0.855	0.860	RNF31_MOUSE E3 ubiquitin-protein ligase RNF31 OS=Mus musculus OX=10090 GN=Rnf31 PE=1 SV=2
2	Q96EP0	0.0	2190	1072	1.000	1.000	RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31 PE=1 SV=1
3	Q8IPJ3	6.10e-91	323	2892	0.147	0.055	LUBEL_DROME E3 ubiquitin-protein ligase lubel OS=Drosophila melanogaster OX=7227 GN=LUBEL PE=1 SV=2
4	Q9ERU9	1.34e-09	65.1	3053	0.046	0.016	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
5	Q7Z419	4.53e-09	61.2	303	0.048	0.168	R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens OX=9606 GN=RNF144B PE=1 SV=1
6	P49792	2.91e-08	60.8	3224	0.038	0.013	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
7	D4A054	1.04e-07	58.9	3061	0.044	0.015	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
8	A0A8I5YC36	1.11e-07	58.9	3114	0.044	0.015	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
9	M0R3M4	1.17e-07	58.9	3089	0.044	0.015	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
10	Q6ZMZ0	1.29e-07	58.2	732	0.064	0.094	RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens OX=9606 GN=RNF19B PE=1 SV=2
11	P50876	1.90e-07	56.2	292	0.049	0.182	R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=2
12	H7C3G0	2.20e-07	55.8	264	0.049	0.201	H7C3G0_HUMAN RBR-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=1
13	A2A7Q9	4.72e-07	56.6	732	0.063	0.093	RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus OX=10090 GN=Rnf19b PE=1 SV=2
14	O95376	2.65e-06	53.5	493	0.048	0.103	ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1
15	Q6IBL8	2.65e-06	53.5	493	0.048	0.103	Q6IBL8_HUMAN RBR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=ARIH2 PE=2 SV=1
16	Q640Z6	5.26e-06	53.1	1605	0.053	0.036	NU153_XENLA Nuclear pore complex protein Nup153 OS=Xenopus laevis OX=8355 GN=nup153 PE=1 SV=1
17	Q6GMF9	6.86e-06	52.4	515	0.053	0.111	Q6GMF9_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=zgc:91964 PE=2 SV=1
18	Q9Z1K6	8.11e-06	52.0	492	0.049	0.106	ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus OX=10090 GN=Arih2 PE=1 SV=1
19	Q9Y4X5	1.28e-05	51.6	557	0.047	0.090	ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2
20	Q9Z1K5	1.33e-05	51.6	555	0.047	0.090	ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus OX=10090 GN=Arih1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18091 E3_UbLigase_RBR	1.6e-28	110.0	E3 Ubiquitin Ligase RBR C-terminal domain
2	PF16678 HOIP-UBA	1.3e-48	176.3	HOIP UBA domain pair
3	PF01485 IBR	0.00036	31.9	IBR domain, a half RING-finger domain
4	PF09409 PUB	3.3e-12	57.5	PUB domain
5	PF18486 PUB_1	1.3e-31	119.6	PNGase/UBA- or UBX-containing domain
6	PF00627 UBA	5.5e+02	11.9	UBA/TS-N domain
7	PF00641 zf-RanBP	0.1	23.3	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315112

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284274	0.999	Ubiquitin thioesterase otulin
2	9606.ENSP00000348632	0.999	RanBP-type and C3HC4-type zinc finger-containing protein 1
3	9606.ENSP00000381698	0.999	Sharpin
4	9606.ENSP00000392025	0.999	Ubiquitin carboxyl-terminal hydrolase CYLD
5	9606.ENSP00000483825	0.997	NF-kappa-B essential modulator
6	9606.ENSP00000381717	0.995	Ubiquitin-conjugating enzyme E2 D2
7	9606.ENSP00000416799	0.991	Spermatogenesis-associated protein 2
8	9606.ENSP00000162749	0.987	Tumor necrosis factor receptor superfamily member 1A
9	9606.ENSP00000441543	0.987	Polyubiquitin-C
10	9606.ENSP00000398698	0.985	Tumor necrosis factor
11	9606.ENSP00000481570	0.979	Tumor necrosis factor alpha-induced protein 3
12	9606.ENSP00000259808	0.975	Receptor-interacting serine/threonine-protein kinase 1
13	9606.ENSP00000477613	0.975	Baculoviral IAP repeat-containing protein 2
14	9606.ENSP00000400906	0.969	Ubiquitin-conjugating enzyme E2L 3
15	9606.ENSP00000258886	0.947	Iron-responsive element-binding protein 2
16	9606.ENSP00000462729	0.944	OTU domain-containing protein 7B
17	9606.ENSP00000260187	0.934	Ubiquitin carboxyl-terminal hydrolase 2
18	9606.ENSP00000265560	0.927	Ubiquitin carboxyl-terminal hydrolase 4
19	9606.ENSP00000363019	0.925	Ubiquitin-conjugating enzyme E2 D1
20	9606.ENSP00000356981	0.914	Ubiquitin carboxyl-terminal hydrolase 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019787	0.995	ubiquitin-like protein transferase activity
GO:0004842	0.991	ubiquitin-protein transferase activity
GO:0019899	0.990	enzyme binding
GO:0061630	0.981	ubiquitin protein ligase activity
GO:0043130	0.972	ubiquitin binding
GO:0042802	0.970	identical protein binding
GO:0031625	0.887	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0009987	0.991	cellular process
GO:0048583	0.990	regulation of response to stimulus
GO:0023051	0.989	regulation of signaling
GO:0010646	0.988	regulation of cell communication
GO:0050896	0.986	response to stimulus
GO:0019538	0.985	protein metabolic process
GO:0016567	0.983	protein ubiquitination
GO:0043123	0.978	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0007165	0.975	signal transduction
GO:0065009	0.956	regulation of molecular function
GO:0002682	0.949	regulation of immune system process
GO:0007166	0.945	cell surface receptor signaling pathway
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:0010468	0.936	regulation of gene expression
GO:0080090	0.935	regulation of primary metabolic process
GO:0031323	0.935	regulation of cellular metabolic process
GO:0044419	0.930	biological process involved in interspecies interaction between organisms
GO:0051090	0.919	regulation of DNA-binding transcription factor activity
GO:0050776	0.912	regulation of immune response
GO:0031347	0.903	regulation of defense response
GO:0002684	0.898	positive regulation of immune system process
GO:0009893	0.890	positive regulation of metabolic process
GO:0032101	0.866	regulation of response to external stimulus
GO:0006950	0.860	response to stress
GO:0044093	0.825	positive regulation of molecular function
GO:0002376	0.821	immune system process
GO:0060341	0.765	regulation of cellular localization
GO:0032880	0.756	regulation of protein localization
GO:0031325	0.739	positive regulation of cellular metabolic process
GO:0051091	0.729	positive regulation of DNA-binding transcription factor activity
GO:0050778	0.680	positive regulation of immune response
GO:0000209	0.595	protein polyubiquitination
GO:0002831	0.589	regulation of response to biotic stimulus
GO:0051707	0.582	response to other organism
GO:0051092	0.577	positive regulation of NF-kappaB transcription factor activity
GO:0044237	0.509	cellular metabolic process
GO:0048519	0.506	negative regulation of biological process
GO:0010604	0.486	positive regulation of macromolecule metabolic process
GO:0031349	0.484	positive regulation of defense response
GO:0051173	0.472	positive regulation of nitrogen compound metabolic process
GO:0002757	0.457	immune response-activating signaling pathway
GO:0032103	0.440	positive regulation of response to external stimulus
GO:0048523	0.438	negative regulation of cellular process
GO:0006952	0.401	defense response
GO:0070201	0.343	regulation of establishment of protein localization
GO:0050851	0.340	antigen receptor-mediated signaling pathway
GO:0098542	0.335	defense response to other organism
GO:0006508	0.334	proteolysis
GO:0051223	0.328	regulation of protein transport
GO:0010941	0.326	regulation of cell death
GO:0050852	0.322	T cell receptor signaling pathway
GO:0033157	0.316	regulation of intracellular protein transport
GO:1903829	0.306	positive regulation of protein localization
GO:0051246	0.302	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0016020	0.981	membrane
GO:0005886	0.956	plasma membrane
GO:1902494	0.925	catalytic complex
GO:0140535	0.905	intracellular protein-containing complex
GO:1990234	0.848	transferase complex
GO:0043226	0.806	organelle
GO:0043227	0.789	membrane-bounded organelle
GO:0043231	0.777	intracellular membrane-bounded organelle
GO:0000151	0.693	ubiquitin ligase complex
GO:0070013	0.552	intracellular organelle lumen
GO:0031981	0.537	nuclear lumen
GO:0098796	0.465	membrane protein complex
GO:0005654	0.446	nucleoplasm
GO:0071797	0.369	LUBAC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.

[back to server]