StarFunc result for job id Q96EP1

User Input

>input (664 residues)
MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDH
CRIVVDEKSGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLY
ESLSEKQGMTQESFEANKENVFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPSTS
TSDLFPTASASSTEPSPAGRERSSSCGSGGGGISPKGSGPSVASDEVSSFASALPDRKTA
SFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRNAQTVHEDVRAAAGKPDKMEE
TLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVE
AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSD
ISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQG
SHALCTCCFQPMPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELN
LGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVL
CYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQT
RFKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EP1	1.000	1.000	0.000	664	1.000	1.000	Q96EP1.pdb.gz	CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR PE=1 SV=2
2	AFDB:Q810L3	0.595	0.595	7.672E-99	664	0.824	0.824	Q810L3.pdb.gz	CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus OX=10090 GN=Chfr PE=1 SV=1
3	AFDB:Q5PSV9	0.152	0.062	6.915E-7	1707	0.120	0.047	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
4	AFDB:Q14676	0.155	0.052	1.276E-6	2089	0.105	0.034	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
5	PDB:7dvqX	0.143	0.566	1.887E-6	156	0.035	0.147	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
6	PDB:2ff4A	0.137	0.235	4.352E-6	379	0.030	0.053	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
7	AFDB:Q9Y4F5	0.139	0.063	1.253E-5	1589	0.114	0.048	Q9Y4F5.pdb.gz	C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4
8	AFDB:O96685	0.127	0.070	2.444E-5	1261	0.089	0.047	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
9	PDB:5gm6U	0.150	0.508	5.338E-5	176	0.039	0.148	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
10	PDB:2kb3A	0.124	0.522	1.231E-4	143	0.033	0.154	2kb3A.pdb.gz
11	PDB:5z56X	0.140	0.519	6.192E-4	159	0.027	0.113	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
12	PDB:4r8pL	0.107	0.261	3.114E-3	254	0.039	0.102	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:7wrgA	0.138	0.114	5.436E-3	812	0.030	0.025	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
14	AFDB:Q9JIL9	0.143	0.128	8.478E-3	750	0.113	0.100	Q9JIL9.pdb.gz	NBN_RAT Nibrin OS=Rattus norvegicus OX=10116 GN=Nbn PE=1 SV=2
15	PDB:2kfuA	0.138	0.492	8.489E-3	162	0.038	0.154	2kfuA.pdb.gz
16	AFDB:Q9R207	0.139	0.124	1.184E-2	751	0.127	0.112	Q9R207.pdb.gz	NBN_MOUSE Nibrin OS=Mus musculus OX=10090 GN=Nbn PE=1 SV=1
17	PDB:6l9wD	0.110	0.480	1.254E-2	142	0.015	0.070	6l9wD.pdb.gz
18	PDB:5dkaA	0.069	0.456	2.188E-2	96	0.021	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
19	AFDB:P29503	0.086	0.078	2.311E-2	754	0.078	0.069	P29503.pdb.gz	NEUR_DROME Protein neuralized OS=Drosophila melanogaster OX=7227 GN=neur PE=1 SV=2
20	AFDB:Q8GSA7	0.051	0.039	2.731E-2	1032	0.078	0.050	Q8GSA7.pdb.gz	CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana OX=3702 GN=CAMTA3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5FWP4	0.0	828	625	0.646	0.686	CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis OX=8355 GN=chfr PE=1 SV=1
2	Q810L3	0.0	1110	664	0.815	0.815	CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus OX=10090 GN=Chfr PE=1 SV=1
3	Q96EP1	0.0	1376	664	1.000	1.000	CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR PE=1 SV=2
4	Q382W2	4.27e-32	133	557	0.194	0.232	Q382W2_TRYB2 E3 ubiquitin-protein ligase CHFR OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4020 PE=3 SV=1
5	Q8VC56	3.65e-07	55.5	488	0.045	0.061	RNF8_MOUSE E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1
6	O76064	5.91e-07	55.1	485	0.048	0.066	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
7	O74747	4.66e-06	51.6	387	0.033	0.057	RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp18 PE=3 SV=1
8	K4P3M7	9.84e-06	51.2	683	0.030	0.029	K4P3M7_9ALPH Immediate-early transactivator protein with Zn finger (Cell nucleus) OS=Bovine herpesvirus type 1.1 OX=79889 GN=BICP0 PE=1 SV=1
9	P29128	9.89e-06	51.2	676	0.030	0.030	ICP0_BHV1J E3 ubiquitin-protein ligase ICP0 OS=Bovine herpesvirus 1.1 (strain Jura) OX=31518 GN=BICP0 PE=1 SV=1
10	Q6PJ69	3.11e-05	49.3	517	0.042	0.054	TRI65_HUMAN E3 ubiquitin-protein ligase TRIM65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3
11	A0A060IVL7	5.48e-05	48.5	548	0.051	0.062	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
12	E7F8P0	5.53e-05	48.5	548	0.051	0.062	E7F8P0_DANRE Tripartite motif-containing 69 OS=Danio rerio OX=7955 GN=rnf36 PE=4 SV=1
13	Q8C006	6.00e-05	48.5	501	0.048	0.064	TRI35_MOUSE E3 ubiquitin-protein ligase TRIM35 OS=Mus musculus OX=10090 GN=Trim35 PE=1 SV=2
14	Q8BTQ0	7.96e-05	47.0	241	0.026	0.071	PCGF3_MOUSE Polycomb group RING finger protein 3 OS=Mus musculus OX=10090 GN=PcgF3 PE=1 SV=1
15	Q8R023	9.09e-05	47.0	259	0.038	0.097	PCGF1_MOUSE Polycomb group RING finger protein 1 OS=Mus musculus OX=10090 GN=Pcgf1 PE=2 SV=2
16	Q9BSM1	9.09e-05	47.0	259	0.038	0.097	PCGF1_HUMAN Polycomb group RING finger protein 1 OS=Homo sapiens OX=9606 GN=PCGF1 PE=1 SV=2
17	Q94AY3	1.03e-04	47.8	420	0.039	0.062	DRIP2_ARATH E3 ubiquitin protein ligase DRIP2 OS=Arabidopsis thaliana OX=3702 GN=DRIP2 PE=1 SV=1
18	Q3KNV8	1.10e-04	46.6	242	0.026	0.070	PCGF3_HUMAN Polycomb group RING finger protein 3 OS=Homo sapiens OX=9606 GN=PCGF3 PE=1 SV=1
19	Q9R207	1.26e-04	47.8	751	0.045	0.040	NBN_MOUSE Nibrin OS=Mus musculus OX=10090 GN=Nbn PE=1 SV=1
20	F4ICB5	1.38e-04	47.4	491	0.048	0.065	F4ICB5_ARATH Zinc finger (C3HC4-type RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=IAP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	1.6e-11	55.7	FHA domain
2	PF17913 FHA_2	3.6e+02	12.8	FHA domain
3	PF07971 Glyco_hydro_92	2.3e+02	12.1	Glycosyl hydrolase family 92
4	PF15681 LAX	76	13.6	Lymphocyte activation family X
5	PF16697 Yop-YscD_cpl	0.019	26.5	Inner membrane component of T3SS, cytoplasmic domain
6	PF00097 zf-C3HC4	0.072	24.3	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	4.4e-05	34.5	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.0014	29.7	Zinc finger, C3HC4 type (RING finger)
9	PF10283 zf-CCHH	0.00052	31.2	PBZ domain
10	PF17979 zf-CRD	3.5e-44	162.3	Cysteine rich domain with multizinc binding regions
11	PF12678 zf-rbx1	1.9	20.2	RING-H2 zinc finger domain
12	PF13639 zf-RING_2	0.0015	30.2	Ring finger domain
13	PF14835 zf-RING_6	3	19.1	zf-RING of BARD1-type protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392395

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355759	0.930	Poly [ADP-ribose] polymerase 1
2	9606.ENSP00000307004	0.921	Aprataxin and PNK-like factor
3	9606.ENSP00000216911	0.854	Aurora kinase A
4	9606.ENSP00000381717	0.853	Ubiquitin-conjugating enzyme E2 D2
5	9606.ENSP00000316176	0.817	Ubiquitin-conjugating enzyme E2 N
6	9606.ENSP00000362649	0.816	Histone deacetylase 1
7	9606.ENSP00000363019	0.802	Ubiquitin-conjugating enzyme E2 D1
8	9606.ENSP00000300093	0.782	Serine/threonine-protein kinase PLK1
9	9606.ENSP00000160827	0.748	Kinesin-like protein KIF22
10	9606.ENSP00000400806	0.727	Aprataxin
11	9606.ENSP00000308944	0.724	Helicase-like transcription factor
12	9606.ENSP00000349722	0.723	Ubiquitin conjugating enzyme E2 D3
13	9606.ENSP00000343535	0.691	Ubiquitin carboxyl-terminal hydrolase 7
14	9606.ENSP00000367787	0.673	DNA ligase 3
15	9606.ENSP00000359685	0.645	Protein tyrosine phosphatase type IVA 1
16	9606.ENSP00000386911	0.640	Rho GTPase-activating protein 25
17	9606.ENSP00000349547	0.635	Ras association domain-containing protein 1
18	9606.ENSP00000262887	0.630	DNA repair protein XRCC1
19	9606.ENSP00000194530	0.616	STE20-related kinase adapter protein beta
20	9606.ENSP00000302111	0.611	Methylated-DNA--protein-cysteine methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:1901363	0.992	heterocyclic compound binding
GO:0097159	0.992	organic cyclic compound binding
GO:0036094	0.803	small molecule binding
GO:1901265	0.785	nucleoside phosphate binding
GO:0000166	0.784	nucleotide binding
GO:0061659	0.619	ubiquitin-like protein ligase activity
GO:0061630	0.590	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0016567	0.988	protein ubiquitination
GO:0051716	0.986	cellular response to stimulus
GO:0000209	0.951	protein polyubiquitination
GO:1901575	0.947	organic substance catabolic process
GO:0044260	0.937	cellular macromolecule metabolic process
GO:0019941	0.933	modification-dependent protein catabolic process
GO:0010564	0.931	regulation of cell cycle process
GO:0048523	0.929	negative regulation of cellular process
GO:0007154	0.925	cell communication
GO:0007165	0.920	signal transduction
GO:0000278	0.913	mitotic cell cycle
GO:0045786	0.905	negative regulation of cell cycle
GO:0007346	0.878	regulation of mitotic cell cycle
GO:1901987	0.873	regulation of cell cycle phase transition
GO:1901990	0.842	regulation of mitotic cell cycle phase transition
GO:1903047	0.834	mitotic cell cycle process
GO:0045930	0.810	negative regulation of mitotic cell cycle
GO:0051128	0.801	regulation of cellular component organization
GO:0019222	0.799	regulation of metabolic process
GO:0010948	0.795	negative regulation of cell cycle process
GO:1901988	0.792	negative regulation of cell cycle phase transition
GO:0033044	0.775	regulation of chromosome organization
GO:0060255	0.773	regulation of macromolecule metabolic process
GO:0000075	0.770	cell cycle checkpoint signaling
GO:0051983	0.761	regulation of chromosome segregation
GO:0033045	0.737	regulation of sister chromatid segregation
GO:0051171	0.730	regulation of nitrogen compound metabolic process
GO:0048518	0.725	positive regulation of biological process
GO:1901991	0.721	negative regulation of mitotic cell cycle phase transition
GO:1902099	0.717	regulation of metaphase/anaphase transition of cell cycle
GO:0080090	0.713	regulation of primary metabolic process
GO:0051985	0.656	negative regulation of chromosome segregation
GO:1902100	0.656	negative regulation of metaphase/anaphase transition of cell cycle
GO:0007093	0.596	mitotic cell cycle checkpoint signaling
GO:0048522	0.587	positive regulation of cellular process
GO:0031323	0.569	regulation of cellular metabolic process
GO:1905818	0.564	regulation of chromosome separation
GO:1905819	0.550	negative regulation of chromosome separation
GO:0006511	0.547	ubiquitin-dependent protein catabolic process
GO:0010604	0.456	positive regulation of macromolecule metabolic process
GO:0051173	0.450	positive regulation of nitrogen compound metabolic process
GO:0031325	0.406	positive regulation of cellular metabolic process
GO:0006950	0.379	response to stress
GO:0010389	0.357	regulation of G2/M transition of mitotic cell cycle
GO:0033554	0.352	cellular response to stress
GO:0031577	0.350	spindle checkpoint signaling
GO:0051246	0.324	regulation of protein metabolic process
GO:0031399	0.313	regulation of protein modification process
GO:0010972	0.306	negative regulation of G2/M transition of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.996	nuclear body
GO:0016605	0.994	PML body
GO:0005829	0.719	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]