StarFunc result for job id Q96EP9

User Input

>input (437 residues)
MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSP
GPTPTPEPTTSGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGL
GCTVDVNHFGAHVRRPVGALLAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGG
NLSNLMSLLVDGDMNLSIIMTISSTLLALVLMPLCLWIYSWAWINTPIVQLLPLGTVTLT
LCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVLFIMTGTMLGPELLASIPAAV
YVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSM
YMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYG
TVKAENIIMMETAQTSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EP9	1.000	1.000	9.034E-54	437	1.000	1.000	Q96EP9.pdb.gz	NTCP4_HUMAN Sodium/bile acid cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC10A4 PE=1 SV=2
2	AFDB:Q3UEZ8	0.755	0.755	8.127E-47	437	0.870	0.870	Q3UEZ8.pdb.gz	NTCP4_MOUSE Sodium/bile acid cotransporter 4 OS=Mus musculus OX=10090 GN=Slc10a4 PE=2 SV=1
3	AFDB:Q3KNW5	0.665	0.767	2.589E-20	377	0.263	0.305	Q3KNW5.pdb.gz	SOAT_HUMAN Sodium-dependent organic anion transporter OS=Homo sapiens OX=9606 GN=SLC10A6 PE=1 SV=2
4	AFDB:Q70EX6	0.597	0.692	4.135E-20	370	0.265	0.314	Q70EX6.pdb.gz	SOAT_RAT Sodium-dependent organic anion transporter OS=Rattus norvegicus OX=10116 GN=Slc10a6 PE=1 SV=1
5	AFDB:Q14973	0.628	0.777	1.055E-19	349	0.270	0.338	Q14973.pdb.gz	NTCP_HUMAN Hepatic sodium/bile acid cotransporter OS=Homo sapiens OX=9606 GN=SLC10A1 PE=1 SV=1
6	AFDB:O08705	0.620	0.741	1.101E-19	362	0.275	0.331	O08705.pdb.gz	NTCP_MOUSE Hepatic sodium/bile acid cotransporter OS=Mus musculus OX=10090 GN=Slc10a1 PE=1 SV=1
7	AFDB:A0A2R8RW10	0.643	0.771	1.759E-19	361	0.277	0.335	A0A2R8RW10.pdb.gz
8	AFDB:Q12908	0.633	0.787	3.787E-19	348	0.256	0.322	Q12908.pdb.gz	NTCP2_HUMAN Ileal sodium/bile acid cotransporter OS=Homo sapiens OX=9606 GN=SLC10A2 PE=1 SV=2
9	AFDB:P70172	0.612	0.758	5.555E-19	348	0.254	0.319	P70172.pdb.gz	NTCP2_MOUSE Ileal sodium/bile acid cotransporter OS=Mus musculus OX=10090 GN=Slc10a2 PE=1 SV=2
10	PDB:7vadA	0.540	0.735	1.238E-15	306	0.254	0.363	7vadA.pdb.gz
11	AFDB:P21129	0.580	0.538	4.818E-14	473	0.195	0.180	P21129.pdb.gz	P3_MOUSE P3 protein OS=Mus musculus OX=10090 GN=Slc10a3 PE=2 SV=2
12	PDB:4czbB	0.394	0.407	4.872E-3	419	0.114	0.119	4czbB.pdb.gz
13	PDB:7qp9A	0.304	0.379	1.298E-2	327	0.108	0.144	7qp9A.pdb.gz	Structures and mechanism of the plant PIN-FORMED auxin transporter.
14	PDB:4bwzA	0.392	0.436	7.127E-2	384	0.117	0.133	4bwzA.pdb.gz	A two-domain elevator mechanism for sodium/proton antiport.
15	PDB:7b4mA	0.201	0.194	1.188E-1	459	0.092	0.087	7b4mA.pdb.gz
16	PDB:6nwdA	0.192	0.283	2.250E-1	246	0.092	0.163	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
17	PDB:6ob6B	0.127	0.147	2.348E-1	357	0.114	0.140	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
18	PDB:7oixB	0.188	0.185	2.451E-1	451	0.110	0.106	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
19	PDB:1pw4A	0.147	0.148	3.164E-1	434	0.110	0.111	1pw4A.pdb.gz
20	PDB:2nq2A	0.132	0.156	5.743E-1	308	0.085	0.120	2nq2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UEZ8	0.0	717	437	0.865	0.865	NTCP4_MOUSE Sodium/bile acid cotransporter 4 OS=Mus musculus OX=10090 GN=Slc10a4 PE=2 SV=1
2	Q96EP9	0.0	876	437	1.000	1.000	NTCP4_HUMAN Sodium/bile acid cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC10A4 PE=1 SV=2
3	O08705	4.29e-69	225	362	0.279	0.337	NTCP_MOUSE Hepatic sodium/bile acid cotransporter OS=Mus musculus OX=10090 GN=Slc10a1 PE=1 SV=1
4	Q14973	1.56e-66	218	349	0.288	0.361	NTCP_HUMAN Hepatic sodium/bile acid cotransporter OS=Homo sapiens OX=9606 GN=SLC10A1 PE=1 SV=1
5	P26435	7.41e-65	214	362	0.272	0.329	NTCP_RAT Hepatic sodium/bile acid cotransporter OS=Rattus norvegicus OX=10116 GN=Slc10a1 PE=1 SV=1
6	P70172	3.89e-64	212	348	0.268	0.336	NTCP2_MOUSE Ileal sodium/bile acid cotransporter OS=Mus musculus OX=10090 GN=Slc10a2 PE=1 SV=2
7	Q12908	3.14e-63	209	348	0.256	0.322	NTCP2_HUMAN Ileal sodium/bile acid cotransporter OS=Homo sapiens OX=9606 GN=SLC10A2 PE=1 SV=2
8	Q62633	1.14e-62	208	348	0.249	0.313	NTCP2_RAT Ileal sodium/bile acid cotransporter OS=Rattus norvegicus OX=10116 GN=Slc10a2 PE=2 SV=1
9	Q3KNW5	1.48e-59	201	377	0.247	0.286	SOAT_HUMAN Sodium-dependent organic anion transporter OS=Homo sapiens OX=9606 GN=SLC10A6 PE=1 SV=2
10	Q7T3A9	5.06e-59	199	361	0.270	0.327	Q7T3A9_DANRE Ileal sodium/bile acid cotransporter OS=Danio rerio OX=7955 GN=zgc:63998 PE=2 SV=1
11	Q70EX6	5.72e-59	199	370	0.261	0.308	SOAT_RAT Sodium-dependent organic anion transporter OS=Rattus norvegicus OX=10116 GN=Slc10a6 PE=1 SV=1
12	P21129	9.60e-21	96.7	473	0.167	0.154	P3_MOUSE P3 protein OS=Mus musculus OX=10090 GN=Slc10a3 PE=2 SV=2
13	Q93YR2	5.30e-16	81.6	401	0.142	0.155	BASS1_ARATH Probable sodium/metabolite cotransporter BASS1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BASS1 PE=2 SV=1
14	Q1EBV7	1.18e-14	77.8	409	0.140	0.149	BASS2_ARATH Sodium/pyruvate cotransporter BASS2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BASS2 PE=1 SV=1
15	Q8VYY4	3.69e-07	54.3	409	0.160	0.171	BASS6_ARATH Probable sodium/metabolite cotransporter BASS6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BASS6 PE=2 SV=1
16	Q8RXE8	4.48e-07	54.3	431	0.073	0.074	BASS3_ARATH Probable sodium/metabolite cotransporter BASS3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BASS3 PE=2 SV=1
17	F4JPW1	2.32e-05	48.9	407	0.144	0.155	BASS5_ARATH Probable sodium/metabolite cotransporter BASS5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=BASS5 PE=2 SV=1
18	Q9UPT6	0.090	37.7	1336	0.053	0.017	JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3
19	A2A884	0.13	37.4	2348	0.064	0.012	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
20	Q6PB44	0.28	36.2	1692	0.048	0.012	PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus OX=10090 GN=Ptpn23 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01758 SBF	1.6e-30	117.8	Sodium Bile acid symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000421275	0.801	Sodium/bile acid cotransporter 7
2	9606.ENSP00000362841	0.718	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1
3	9606.ENSP00000412524	0.695	Transmembrane protein 169
4	9606.ENSP00000437289	0.633	ZAR1-like protein
5	9606.ENSP00000329803	0.609	Zygote arrest protein 1
6	9606.ENSP00000351113	0.607	Protein furry homolog-like
7	9606.ENSP00000363229	0.599	Vesicular acetylcholine transporter
8	9606.ENSP00000296327	0.565	Organic solute transporter subunit alpha
9	9606.ENSP00000264047	0.521	High affinity choline transporter 1
10	9606.ENSP00000368758	0.515	Cortexin-3
11	9606.ENSP00000315602	0.507	Neuronal acetylcholine receptor subunit alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022857	0.976	transmembrane transporter activity
GO:0008514	0.941	organic anion transmembrane transporter activity
GO:0005342	0.856	organic acid transmembrane transporter activity
GO:0015318	0.847	inorganic molecular entity transmembrane transporter activity
GO:0046943	0.834	carboxylic acid transmembrane transporter activity
GO:0015075	0.747	monoatomic ion transmembrane transporter activity
GO:0022804	0.661	active transmembrane transporter activity
GO:0008028	0.622	monocarboxylic acid transmembrane transporter activity
GO:0008324	0.614	monoatomic cation transmembrane transporter activity
GO:1901702	0.557	salt transmembrane transporter activity
GO:0015291	0.508	secondary active transmembrane transporter activity
GO:1901618	0.384	organic hydroxy compound transmembrane transporter activity
GO:0022890	0.384	inorganic cation transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.962	biological regulation
GO:0050789	0.825	regulation of biological process
GO:0050896	0.746	response to stimulus
GO:0050794	0.648	regulation of cellular process
GO:0009987	0.633	cellular process
GO:0051179	0.555	localization
GO:0006810	0.538	transport
GO:0042221	0.451	response to chemical
GO:0032501	0.375	multicellular organismal process
GO:0071702	0.334	organic substance transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0005737	0.956	cytoplasm
GO:0071944	0.936	cell periphery
GO:0031982	0.909	vesicle
GO:0005886	0.873	plasma membrane
GO:0031090	0.851	organelle membrane
GO:0045202	0.600	synapse
GO:0031410	0.568	cytoplasmic vesicle
GO:0098588	0.526	bounding membrane of organelle
GO:0030659	0.476	cytoplasmic vesicle membrane
GO:0030133	0.465	transport vesicle
GO:0099503	0.393	secretory vesicle
GO:0030658	0.392	transport vesicle membrane
GO:0098793	0.336	presynapse
GO:0070382	0.331	exocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]