StarFunc result for job id Q96EQ8

User Input

>input (232 residues)
MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDEN
PSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EQ8	1.000	1.000	1.773E-46	232	1.000	1.000	Q96EQ8.pdb.gz	RN125_HUMAN E3 ubiquitin-protein ligase RNF125 OS=Homo sapiens OX=9606 GN=RNF125 PE=1 SV=4
2	AFDB:Q9D9R0	0.505	0.503	3.315E-39	233	0.858	0.854	Q9D9R0.pdb.gz	RN125_MOUSE E3 ubiquitin-protein ligase RNF125 OS=Mus musculus OX=10090 GN=Rnf125 PE=2 SV=3
3	PDB:5dkaA	0.406	0.964	1.362E-17	96	0.414	1.000	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
4	AFDB:Q9Y508	0.376	0.381	8.985E-17	228	0.302	0.307	Q9Y508.pdb.gz	RN114_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
5	AFDB:Q1L721	0.399	0.416	7.112E-16	222	0.293	0.306	Q1L721.pdb.gz	RN138_XENLA E3 ubiquitin-protein ligase RNF138 OS=Xenopus laevis OX=8355 GN=rnf138 PE=1 SV=1
6	AFDB:Q96A37	0.390	0.385	2.134E-15	237	0.319	0.312	Q96A37.pdb.gz	RN166_HUMAN E3 ubiquitin-protein ligase RNF166 OS=Homo sapiens OX=9606 GN=RNF166 PE=1 SV=1
7	AFDB:Q8WVD3	0.409	0.388	7.473E-14	245	0.276	0.261	Q8WVD3.pdb.gz	RN138_HUMAN E3 ubiquitin-protein ligase RNF138 OS=Homo sapiens OX=9606 GN=RNF138 PE=1 SV=1
8	AFDB:A0A096LP02	0.366	0.409	1.235E-11	206	0.211	0.238	A0A096LP02.pdb.gz	A0A096LP02_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
9	AFDB:Q9UAC4	0.320	0.166	8.802E-10	475	0.224	0.109	Q9UAC4.pdb.gz	Q9UAC4_DROME TRAF6 OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=2 SV=1
10	AFDB:Q9Y4K3	0.316	0.152	9.023E-9	522	0.177	0.079	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
11	AFDB:Q6DJN2	0.308	0.139	9.625E-9	556	0.224	0.094	Q6DJN2.pdb.gz	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
12	PDB:4r8pL	0.273	0.250	3.152E-4	254	0.125	0.114	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:5gm6a	0.256	0.465	2.055E-3	123	0.099	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7oikA	0.237	0.016	2.495E-3	4426	0.108	0.006	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
15	PDB:7od1A	0.184	0.108	1.429E-2	430	0.116	0.063	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:5a31B	0.195	0.512	4.882E-2	84	0.056	0.155	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
17	PDB:2c2lA	0.240	0.199	5.555E-2	281	0.052	0.043	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
18	PDB:7qcdC	0.247	0.217	6.322E-2	267	0.082	0.071	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
19	PDB:2lgvA	0.184	0.411	6.744E-2	100	0.060	0.140	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
20	PDB:5l9uB	0.185	0.584	7.675E-2	71	0.056	0.183	5l9uB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EQ8	7.55e-174	478	232	1.000	1.000	RN125_HUMAN E3 ubiquitin-protein ligase RNF125 OS=Homo sapiens OX=9606 GN=RNF125 PE=1 SV=4
2	Q9D9R0	1.44e-141	397	233	0.862	0.858	RN125_MOUSE E3 ubiquitin-protein ligase RNF125 OS=Mus musculus OX=10090 GN=Rnf125 PE=2 SV=3
3	Q9Y508	3.27e-34	124	228	0.284	0.289	RN114_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
4	Q96A37	3.44e-31	116	237	0.315	0.308	RN166_HUMAN E3 ubiquitin-protein ligase RNF166 OS=Homo sapiens OX=9606 GN=RNF166 PE=1 SV=1
5	Q1L721	1.12e-30	114	222	0.297	0.311	RN138_XENLA E3 ubiquitin-protein ligase RNF138 OS=Xenopus laevis OX=8355 GN=rnf138 PE=1 SV=1
6	Q9CQE0	1.36e-24	99.8	245	0.284	0.269	RN138_MOUSE E3 ubiquitin-protein ligase RNF138 OS=Mus musculus OX=10090 GN=Rnf138 PE=2 SV=1
7	Q8WVD3	4.69e-24	98.2	245	0.284	0.269	RN138_HUMAN E3 ubiquitin-protein ligase RNF138 OS=Homo sapiens OX=9606 GN=RNF138 PE=1 SV=1
8	A0A096LNV3	4.55e-18	80.9	188	0.246	0.303	A0A096LNV3_HUMAN E3 ubiquitin-protein ligase RNF114 (Fragment) OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
9	A0A096LP02	2.83e-17	79.3	206	0.203	0.228	A0A096LP02_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
10	Q6DJN2	4.31e-08	55.5	556	0.220	0.092	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
11	Q9W3I9	4.50e-08	55.1	475	0.172	0.084	Q9W3I9_DROME GH01161p OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=1 SV=1
12	Q9UAC4	5.22e-08	55.1	475	0.172	0.084	Q9UAC4_DROME TRAF6 OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=2 SV=1
13	F4ICB5	8.42e-08	54.3	491	0.103	0.049	F4ICB5_ARATH Zinc finger (C3HC4-type RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=IAP1 PE=1 SV=1
14	Q9UUF0	1.45e-07	53.1	306	0.103	0.078	PEX10_SCHPO Peroxisome biogenesis factor 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pas4 PE=3 SV=1
15	E7EZF3	4.95e-07	52.4	776	0.086	0.026	UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio OX=7955 GN=uhrf1 PE=1 SV=1
16	Q9XYQ9	4.96e-07	52.0	463	0.168	0.084	Q9XYQ9_DROME TNF-receptor-associated factor 2 OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=2 SV=1
17	E1C626	5.03e-07	52.0	545	0.207	0.088	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
18	Q3MV19	9.49e-07	51.2	556	0.194	0.081	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
19	A0A0C4DGA6	1.15e-06	51.2	1008	0.125	0.029	A0A0C4DGA6_HUMAN Helicase like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=1
20	Q14527	1.15e-06	51.2	1009	0.125	0.029	HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.11	23.7	Prokaryotic RING finger family 4
2	PF04423 Rad50_zn_hook	66	14.7	Rad50 zinc hook motif
3	PF04564 U-box	1.4	20.5	U-box domain
4	PF00097 zf-C3HC4	1e-05	36.6	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	2.2e-08	45.1	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.00079	30.5	Zinc finger, C3HC4 type (RING finger)
7	PF15227 zf-C3HC4_4	6.9e-06	37.4	zinc finger of C3HC4-type, RING
8	PF05605 zf-Di19	4.5e-08	44.6	Drought induced 19 protein (Di19), zinc-binding
9	PF11789 zf-Nse	1.3	20.3	Zinc-finger of the MIZ type in Nse subunit
10	PF12678 zf-rbx1	68	15.2	RING-H2 zinc finger domain
11	PF16685 zf-RING_10	1.4	20.4	zinc RING finger of MSL2
12	PF13639 zf-RING_2	0.0001	33.9	Ring finger domain
13	PF14634 zf-RING_5	0.0033	28.7	zinc-RING finger domain
14	PF14835 zf-RING_6	18	16.6	zf-RING of BARD1-type protein
15	PF13445 zf-RING_UBOX	3.3e-06	38.3	RING-type zinc-finger
16	PF18574 zf_C2HC_14	3e-11	54.2	C2HC Zing finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217740

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369213	0.983	Probable ATP-dependent RNA helicase DDX58
2	9606.ENSP00000263642	0.968	Interferon-induced helicase C domain-containing protein 1
3	9606.ENSP00000363019	0.941	Ubiquitin-conjugating enzyme E2 D1
4	9606.ENSP00000331487	0.914	Nuclear protein localization protein 4 homolog
5	9606.ENSP00000263202	0.911	Ubiquitin recognition factor in ER-associated degradation protein 1
6	9606.ENSP00000287156	0.839	Ubiquitin/ISG15-conjugating enzyme E2 L6
7	9606.ENSP00000349722	0.798	Ubiquitin conjugating enzyme E2 D3
8	9606.ENSP00000381717	0.773	Ubiquitin-conjugating enzyme E2 D2
9	9606.ENSP00000323889	0.734	E3 ubiquitin/ISG15 ligase TRIM25
10	9606.ENSP00000401980	0.734	Mitochondrial antiviral-signaling protein
11	9606.ENSP00000294119	0.733	UBX domain-containing protein 1
12	9606.ENSP00000379457	0.722	FAS-associated factor 1
13	9606.ENSP00000261942	0.720	FAS-associated factor 2
14	9606.ENSP00000296328	0.720	UBX domain-containing protein 7
15	9606.ENSP00000328340	0.710	E3 ubiquitin-protein ligase RNF135
16	9606.ENSP00000261427	0.679	Ubiquitin-conjugating enzyme E2 K
17	9606.ENSP00000283351	0.672	Trafficking protein particle complex subunit 8
18	9606.ENSP00000358541	0.659	Suppressor of IKBKE 1
19	9606.ENSP00000379931	0.642	Ubiquitin-conjugating enzyme E2 E2
20	9606.ENSP00000348632	0.634	RanBP-type and C3HC4-type zinc finger-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.994	ubiquitin protein ligase activity
GO:0019899	0.993	enzyme binding
GO:0031624	0.977	ubiquitin conjugating enzyme binding
GO:0002039	0.921	p53 binding
GO:0046914	0.855	transition metal ion binding
GO:0008270	0.787	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.985	protein metabolic process
GO:0009987	0.984	cellular process
GO:0050794	0.971	regulation of cellular process
GO:0070647	0.958	protein modification by small protein conjugation or removal
GO:0016567	0.946	protein ubiquitination
GO:0044237	0.932	cellular metabolic process
GO:0032479	0.928	regulation of type I interferon production
GO:0045088	0.906	regulation of innate immune response
GO:0048519	0.889	negative regulation of biological process
GO:0044260	0.869	cellular macromolecule metabolic process
GO:0050896	0.863	response to stimulus
GO:0006511	0.860	ubiquitin-dependent protein catabolic process
GO:0050688	0.859	regulation of defense response to virus
GO:0009966	0.848	regulation of signal transduction
GO:0031348	0.791	negative regulation of defense response
GO:0002683	0.789	negative regulation of immune system process
GO:0002832	0.789	negative regulation of response to biotic stimulus
GO:0032102	0.786	negative regulation of response to external stimulus
GO:0062207	0.786	regulation of pattern recognition receptor signaling pathway
GO:0050687	0.763	negative regulation of defense response to virus
GO:0009892	0.687	negative regulation of metabolic process
GO:0051716	0.670	cellular response to stimulus
GO:0010605	0.651	negative regulation of macromolecule metabolic process
GO:0048523	0.614	negative regulation of cellular process
GO:0023057	0.571	negative regulation of signaling
GO:0010648	0.562	negative regulation of cell communication
GO:0032480	0.556	negative regulation of type I interferon production
GO:0000209	0.540	protein polyubiquitination
GO:0039531	0.432	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0048518	0.419	positive regulation of biological process
GO:0009968	0.414	negative regulation of signal transduction
GO:0042221	0.397	response to chemical
GO:0010033	0.358	response to organic substance
GO:0051171	0.308	regulation of nitrogen compound metabolic process
GO:0031323	0.304	regulation of cellular metabolic process
GO:0048522	0.301	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0012505	0.994	endomembrane system
GO:0005829	0.987	cytosol
GO:0032991	0.982	protein-containing complex
GO:0016020	0.978	membrane
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0031090	0.953	organelle membrane
GO:0031984	0.926	organelle subcompartment
GO:0005783	0.844	endoplasmic reticulum
GO:0005789	0.623	endoplasmic reticulum membrane
GO:0098796	0.525	membrane protein complex
GO:0034098	0.504	VCP-NPL4-UFD1 AAA ATPase complex
GO:0098588	0.425	bounding membrane of organelle
GO:0005634	0.362	nucleus
GO:0000139	0.330	Golgi membrane
GO:0071944	0.318	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]