StarFunc result for job id Q96ES7

User Input

>input (293 residues)
MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLR
GLYTTAKADAEAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLM
TLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEV
VSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQ
TTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C606	0.988	0.988	6.934E-55	293	0.986	0.986	P0C606.pdb.gz	SGF29_RAT SAGA-associated factor 29 OS=Rattus norvegicus OX=10116 GN=Sgf29 PE=1 SV=1
2	AFDB:Q9W2I4	0.871	0.882	1.969E-34	289	0.485	0.491	Q9W2I4.pdb.gz	Q9W2I4_DROME FI01566p OS=Drosophila melanogaster OX=7227 GN=Sgf29 PE=1 SV=2
3	AFDB:Q500Z7	0.366	0.390	1.279E-13	273	0.242	0.260	Q500Z7.pdb.gz	SG29B_ARATH SAGA-associated factor 29 homolog B OS=Arabidopsis thaliana OX=3702 GN=SGF29B PE=2 SV=1
4	AFDB:Q1ZXN8	0.374	0.272	9.007E-12	411	0.177	0.127	Q1ZXN8.pdb.gz	Q1ZXN8_DICDI DUF1325 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272054 PE=4 SV=1
5	AFDB:P25554	0.396	0.444	1.633E-9	259	0.164	0.185	P25554.pdb.gz	SGF29_YEAST SAGA-associated factor 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGF29 PE=1 SV=2
6	PDB:3mp8A	0.365	0.216	3.915E-8	513	0.119	0.068	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
7	PDB:7abi7	0.187	0.223	4.186E-4	236	0.075	0.093	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
8	AFDB:O94519	0.182	0.173	1.159E-3	311	0.089	0.084	O94519.pdb.gz	SPF30_SCHPO Splicing factor spf30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spf30 PE=1 SV=1
9	AFDB:P51116	0.229	0.114	1.159E-3	673	0.072	0.031	P51116.pdb.gz	FXR2_HUMAN RNA-binding protein FXR2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2
10	AFDB:F4JP43	0.251	0.050	1.304E-3	2037	0.160	0.023	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
11	AFDB:F1R159	0.233	0.135	1.652E-3	569	0.051	0.026	F1R159.pdb.gz
12	AFDB:Q9NFU0	0.253	0.123	1.652E-3	684	0.072	0.031	Q9NFU0.pdb.gz	FMR1_DROME Fragile X messenger ribonucleoprotein 1 homolog OS=Drosophila melanogaster OX=7227 GN=Fmr1 PE=1 SV=1
13	PDB:7r1dC	0.158	0.232	3.121E-3	192	0.099	0.151	7r1dC.pdb.gz
14	PDB:7okyZ	0.156	0.128	8.034E-3	374	0.065	0.051	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
15	PDB:3p8bB	0.166	0.316	1.451E-2	147	0.048	0.095	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
16	PDB:2b5uA	0.307	0.197	1.949E-2	470	0.102	0.064	2b5uA.pdb.gz
17	PDB:4zn3A	0.178	0.330	2.619E-2	147	0.034	0.068	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
18	PDB:7un3A	0.141	0.069	2.619E-2	649	0.058	0.026	7un3A.pdb.gz
19	PDB:6pwnA	0.162	0.169	7.588E-2	280	0.099	0.104	6pwnA.pdb.gz
20	PDB:2ns2A	0.157	0.220	8.050E-2	201	0.048	0.070	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C606	0.0	600	293	0.986	0.986	SGF29_RAT SAGA-associated factor 29 OS=Rattus norvegicus OX=10116 GN=Sgf29 PE=1 SV=1
2	Q96ES7	0.0	605	293	1.000	1.000	SGF29_HUMAN SAGA-associated factor 29 OS=Homo sapiens OX=9606 GN=SGF29 PE=1 SV=1
3	Q9DA08	0.0	598	293	0.983	0.983	SGF29_MOUSE SAGA-associated factor 29 OS=Mus musculus OX=10090 GN=Sgf29 PE=1 SV=1
4	Q9W2I4	7.56e-92	276	289	0.485	0.491	Q9W2I4_DROME FI01566p OS=Drosophila melanogaster OX=7227 GN=Sgf29 PE=1 SV=2
5	Q8RXY6	6.47e-16	78.2	270	0.290	0.315	SG29A_ARATH SAGA-associated factor 29 homolog A OS=Arabidopsis thaliana OX=3702 GN=SGF29A PE=1 SV=1
6	Q1ZXN8	5.50e-13	70.9	411	0.171	0.122	Q1ZXN8_DICDI DUF1325 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272054 PE=4 SV=1
7	Q500Z7	6.73e-11	63.9	273	0.266	0.286	SG29B_ARATH SAGA-associated factor 29 homolog B OS=Arabidopsis thaliana OX=3702 GN=SGF29B PE=2 SV=1
8	P25554	0.35	34.3	259	0.089	0.100	SGF29_YEAST SAGA-associated factor 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGF29 PE=1 SV=2
9	Q4KWH5	0.87	33.9	1682	0.075	0.013	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
10	A0A2U3TZV8	0.99	33.5	1685	0.075	0.013	A0A2U3TZV8_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
11	Q4KWH8	0.99	33.5	1693	0.075	0.013	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
12	Q582L5	2.0	32.0	222	0.058	0.077	Q582L5_TRYB2 Vesicle transport v-SNARE N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.33N13.370 PE=4 SV=1
13	P96901	5.8	31.2	1513	0.061	0.012	P96901_MYCTU Probable ATP-dependent helicase Lhr (Large helicase-related protein) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lhr PE=1 SV=2
14	A0A1B0GWM3	6.2	31.2	3333	0.044	0.004	A0A1B0GWM3_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=2
15	P04635	7.4	30.8	641	0.055	0.025	LIP_STAHY Lipase OS=Staphylococcus hyicus OX=1284 GN=lip PE=1 SV=1
16	Q38A83	9.7	30.4	1664	0.099	0.017	Q38A83_TRYB2 Nucleoporin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1530 PE=4 SV=1
17	Q61789	9.7	30.4	3330	0.044	0.004	LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus OX=10090 GN=Lama3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07039 DUF1325	5.7e-36	135.0	SGF29 tudor-like domain
2	PF00038 Filament	20	16.2	Intermediate filament protein
3	PF00567 TUDOR	49	15.4	Tudor domain
4	PF18115 Tudor_3	44	15.4	DNA repair protein Crb2 Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010386996.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010367709.1	0.990	Transcriptional adapter 3
2	61622.XP_010384973.1	0.983	Belongs to the acetyltransferase family. GCN5 subfamily.
3	61622.XP_010352261.1	0.981	Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Within the complex, it is required to recruit USP22 and ENY2 into the SAGA complex. [...]
4	61622.XP_010375169.1	0.981	Transcriptional adaptor 2A
5	61622.XP_010378636.1	0.981	TATA-box binding protein associated factor 12
6	61622.XP_010364517.1	0.980	YEATS domain-containing protein 2 isoform X1
7	61622.XP_010370842.1	0.979	SPT3 homolog, SAGA and STAGA complex component
8	61622.XP_010368331.1	0.978	Transcriptional adaptor 2B
9	61622.XP_010379789.1	0.978	Lysine acetyltransferase 14
10	61622.XP_010372336.1	0.975	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
11	61622.XP_010365909.1	0.974	Belongs to the acetyltransferase family. GCN5 subfamily.
12	61622.XP_010371678.1	0.971	Transcriptional adapter 1
13	61622.XP_010369496.1	0.970	STAGA complex 65 subunit gamma isoform X1
14	61622.XP_010375985.1	0.970	TATA-box binding protein associated factor 6
15	61622.XP_010363628.1	0.969	MAP3K12-binding inhibitory protein 1 isoform X1
16	61622.XP_010354502.1	0.968	TATA-box binding protein associated factor 5
17	61622.XP_010381862.1	0.968	TATA-box binding protein associated factor 10
18	61622.XP_010383167.1	0.967	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
19	61622.XP_010378973.1	0.964	Zinc finger ZZ-type containing 3
20	61622.XP_010383418.1	0.964	Down-regulator of transcription 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.997	methylated histone binding
GO:0019899	0.974	enzyme binding
GO:0003824	0.300	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051302	0.987	regulation of cell division
GO:0051726	0.986	regulation of cell cycle
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0009987	0.980	cellular process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0019222	0.960	regulation of metabolic process
GO:0016570	0.958	histone modification
GO:0043543	0.956	protein acylation
GO:0006473	0.953	protein acetylation
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0006475	0.943	internal protein amino acid acetylation
GO:0080090	0.938	regulation of primary metabolic process
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:0090311	0.901	regulation of protein deacetylation
GO:0031056	0.898	regulation of histone modification
GO:0018205	0.891	peptidyl-lysine modification
GO:0019219	0.855	regulation of nucleobase-containing compound metabolic process
GO:0016573	0.821	histone acetylation
GO:0010468	0.753	regulation of gene expression
GO:2001141	0.726	regulation of RNA biosynthetic process
GO:0006355	0.713	regulation of DNA-templated transcription
GO:0031063	0.632	regulation of histone deacetylation
GO:0051641	0.603	cellular localization
GO:0043966	0.601	histone H3 acetylation
GO:0016579	0.588	protein deubiquitination
GO:0016578	0.561	histone deubiquitination
GO:0048518	0.528	positive regulation of biological process
GO:0048522	0.497	positive regulation of cellular process
GO:0033036	0.474	macromolecule localization
GO:0006357	0.434	regulation of transcription by RNA polymerase II
GO:0009893	0.381	positive regulation of metabolic process
GO:0070727	0.368	cellular macromolecule localization
GO:0071840	0.354	cellular component organization or biogenesis
GO:0008104	0.352	protein localization
GO:0016043	0.329	cellular component organization
GO:0010604	0.316	positive regulation of macromolecule metabolic process
GO:0034502	0.309	protein localization to chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070461	0.999	SAGA-type complex
GO:0005634	0.996	nucleus
GO:0031981	0.945	nuclear lumen
GO:0140672	0.901	ATAC complex
GO:0005654	0.811	nucleoplasm
GO:0005737	0.402	cytoplasm
GO:0005829	0.325	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]