StarFunc result for job id Q96EW2

User Input

>input (488 residues)
MAAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVFDWPARHWNA
KYLSQVLHGKQIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDH
SKFWAYADYKYFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYG
CNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKRFPQFRKAQRHA
VTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHLARVEEAITRMLVCALKTAEN
PQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTDGEHMKKEELN
VCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDK
DGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFISTDDLLDCLVNPQVTRIVAQ
LLIQGRSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EW2	1.000	1.000	1.105E-94	488	1.000	1.000	Q96EW2.pdb.gz	HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens OX=9606 GN=HSPBAP1 PE=1 SV=1
2	AFDB:Q9VB06	0.528	0.642	4.152E-22	398	0.186	0.229	Q9VB06.pdb.gz	Q9VB06_DROME HSPB1 associated protein 1 OS=Drosophila melanogaster OX=7227 GN=HSPBAP1 PE=4 SV=3
3	AFDB:Q8BLR9	0.393	0.529	3.233E-15	349	0.131	0.183	Q8BLR9.pdb.gz	HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus OX=10090 GN=Hif1an PE=1 SV=2
4	AFDB:P59723	0.372	0.504	9.210E-15	344	0.129	0.183	P59723.pdb.gz	HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio OX=7955 GN=hif1an PE=2 SV=2
5	PDB:4b7eA	0.386	0.518	9.667E-15	349	0.141	0.198	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
6	PDB:3al5B	0.394	0.596	1.205E-14	311	0.123	0.193	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
7	PDB:5nfnB	0.398	0.591	1.361E-13	318	0.113	0.173	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
8	PDB:3al5C	0.376	0.610	1.793E-13	284	0.143	0.246	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
9	PDB:4qszA	0.405	0.296	4.329E-13	686	0.109	0.077	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
10	PDB:7yxgA	0.385	0.579	9.361E-13	313	0.121	0.188	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
11	AFDB:F5GX28	0.322	0.151	1.602E-9	1130	0.121	0.052	F5GX28.pdb.gz	F5GX28_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=2
12	AFDB:A0A0C4DFL8	0.317	0.154	2.936E-9	1096	0.121	0.054	A0A0C4DFL8.pdb.gz	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
13	AFDB:A0A2R8QE74	0.266	0.147	3.278E-9	982	0.096	0.048	A0A2R8QE74.pdb.gz
14	AFDB:Q3U2K5	0.283	0.272	3.660E-9	510	0.102	0.098	Q3U2K5.pdb.gz	KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus OX=10090 GN=Kdm4d PE=2 SV=2
15	AFDB:Q9H3R0	0.263	0.132	3.867E-9	1056	0.117	0.054	Q9H3R0.pdb.gz	KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens OX=9606 GN=KDM4C PE=1 SV=2
16	PDB:4bxfA	0.313	0.353	6.665E-9	425	0.092	0.106	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
17	AFDB:F1QNG0	0.268	0.137	7.491E-9	1045	0.098	0.046	F1QNG0.pdb.gz	F1QNG0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=kdm4ab PE=3 SV=2
18	PDB:4cclB	0.279	0.346	5.119E-8	372	0.078	0.102	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
19	PDB:4bu2A	0.201	0.250	2.394E-7	379	0.072	0.092	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:6nieA	0.256	0.450	1.577E-5	244	0.061	0.123	6nieA.pdb.gz	A family of radical halogenases for the engineering of amino-acid-based products.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EW2	0.0	1027	488	1.000	1.000	HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens OX=9606 GN=HSPBAP1 PE=1 SV=1
2	Q9H641	1.99e-145	416	199	0.408	1.000	Q9H641_HUMAN cDNA: FLJ22623 fis, clone HSI05687 OS=Homo sapiens OX=9606 PE=1 SV=1
3	Q9VB06	1.54e-33	132	398	0.150	0.183	Q9VB06_DROME HSPB1 associated protein 1 OS=Drosophila melanogaster OX=7227 GN=HSPBAP1 PE=4 SV=3
4	A0A0S2Z5T1	2.10e-18	89.4	416	0.139	0.163	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
5	Q8N371	2.10e-18	89.4	416	0.139	0.163	KDM8_HUMAN Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1
6	Q9CXT6	2.68e-17	86.3	414	0.131	0.155	KDM8_MOUSE Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1
7	Q9NWT6	4.94e-17	84.7	349	0.156	0.218	HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2
8	Q8BLR9	7.57e-17	84.0	349	0.111	0.155	HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus OX=10090 GN=Hif1an PE=1 SV=2
9	P59723	5.06e-16	81.6	344	0.131	0.186	HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio OX=7955 GN=hif1an PE=2 SV=2
10	A2RUC4	5.17e-15	78.2	315	0.139	0.216	TYW5_HUMAN tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1
11	Q8RWR1	1.49e-12	71.6	429	0.131	0.149	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
12	Q9W0M3	2.36e-12	70.9	401	0.137	0.167	Q9W0M3_DROME GM21055p OS=Drosophila melanogaster OX=7227 GN=JMJD5 PE=2 SV=2
13	Q38DD6	1.48e-10	66.2	1145	0.080	0.034	Q38DD6_TRYB2 tRNA wybutosine-synthesizing protein 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3730 PE=3 SV=1
14	P0C870	2.46e-10	63.9	316	0.092	0.142	JMJD7_HUMAN Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 OS=Homo sapiens OX=9606 GN=JMJD7 PE=1 SV=1
15	Q9VU77	4.44e-08	57.0	316	0.125	0.193	Q9VU77_DROME GH14974p OS=Drosophila melanogaster OX=7227 GN=JMJD7 PE=1 SV=1
16	Q67ZB6	1.96e-07	55.8	462	0.133	0.141	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
17	Q96S16	2.60e-06	51.2	264	0.080	0.148	JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=JMJD8 PE=1 SV=2
18	Q6PFM0	3.27e-06	51.6	403	0.131	0.159	JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio OX=7955 GN=jmjd6 PE=2 SV=2
19	Q0WVR4	4.58e-06	50.8	345	0.133	0.188	JMJ32_ARATH Lysine-specific demethylase JMJ32 OS=Arabidopsis thaliana OX=3702 GN=JMJ32 PE=1 SV=1
20	Q386V9	3.68e-05	48.5	550	0.111	0.098	Q386V9_TRYB2 JmjC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0007 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00190 Cupin_1	4.6e+02	11.8	Cupin
2	PF13621 Cupin_8	9.2e-35	132.2	Cupin-like domain
3	PF02373 JmjC	5.7	18.8	JmjC domain, hydroxylase
4	PF08007 JmjC_2	7e-05	33.8	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302562

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389455	0.813	Disrupted in renal carcinoma 3
2	9606.ENSP00000248553	0.805	Heat shock protein beta-1
3	9606.ENSP00000355720	0.753	JmjC domain-containing protein 4
4	9606.ENSP00000380544	0.732	2-oxoglutarate and iron dependent oxygenase domain containing 2
5	9606.ENSP00000457258	0.714	Prolyl 3-hydroxylase OGFOD1
6	9606.ENSP00000477507	0.711	Ribosomal oxygenase 1
7	9606.ENSP00000302476	0.684	Heat shock protein beta-2
8	9606.ENSP00000341422	0.673	Transmembrane prolyl 4-hydroxylase
9	9606.ENSP00000261038	0.649	Disrupted in renal carcinoma protein 2
10	9606.ENSP00000338512	0.647	Cytosolic carboxypeptidase 1
11	9606.ENSP00000303394	0.630	Heat shock protein beta-3
12	9606.ENSP00000307860	0.627	Disrupted in renal carcinoma 1
13	9606.ENSP00000328251	0.624	Ribosomal oxygenase 2
14	9606.ENSP00000378611	0.619	Rho GTPase-activating protein 24
15	9606.ENSP00000273261	0.605	Leucine-rich repeats and immunoglobulin-like domains protein 1
16	9606.ENSP00000394085	0.595	Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
17	9606.ENSP00000340823	0.571	General transcription factor IIF subunit 2
18	9606.ENSP00000282272	0.527	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B
19	9606.ENSP00000320917	0.503	KRI1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.871	catalytic activity
GO:0051213	0.825	dioxygenase activity
GO:0016705	0.825	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016706	0.823	2-oxoglutarate-dependent dioxygenase activity
GO:0140096	0.797	catalytic activity, acting on a protein
GO:0032451	0.756	demethylase activity
GO:0140457	0.748	protein demethylase activity
GO:0032452	0.656	histone demethylase activity
GO:0003676	0.357	nucleic acid binding
GO:0043167	0.304	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0071704	0.978	organic substance metabolic process
GO:0050789	0.976	regulation of biological process
GO:0006807	0.971	nitrogen compound metabolic process
GO:0050794	0.969	regulation of cellular process
GO:0009987	0.966	cellular process
GO:0044238	0.908	primary metabolic process
GO:0019222	0.901	regulation of metabolic process
GO:0043170	0.851	macromolecule metabolic process
GO:0060255	0.794	regulation of macromolecule metabolic process
GO:0043412	0.738	macromolecule modification
GO:1901564	0.646	organonitrogen compound metabolic process
GO:0010468	0.606	regulation of gene expression
GO:0080090	0.581	regulation of primary metabolic process
GO:0044237	0.560	cellular metabolic process
GO:0051171	0.549	regulation of nitrogen compound metabolic process
GO:0050896	0.501	response to stimulus
GO:0031323	0.464	regulation of cellular metabolic process
GO:0048518	0.455	positive regulation of biological process
GO:0036211	0.455	protein modification process
GO:0009889	0.395	regulation of biosynthetic process
GO:0031326	0.392	regulation of cellular biosynthetic process
GO:0010556	0.390	regulation of macromolecule biosynthetic process
GO:0048522	0.353	positive regulation of cellular process
GO:0048519	0.351	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0005654	0.937	nucleoplasm
GO:0005829	0.919	cytosol
GO:0043228	0.858	non-membrane-bounded organelle
GO:0043232	0.851	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	0.825	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.11.-	0.823	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]