StarFunc result for job id Q96EY1

User Input

>input (480 residues)
MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRAL
LTLRPGVSLTGTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKY
HPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTV
DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCN
GKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQ
KKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLG
GTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ
QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53G26	0.530	0.530	2.280E-86	480	1.000	1.000	Q53G26.pdb.gz	Q53G26_HUMAN DnaJ (Hsp40) homolog, subfamily A, member 3 variant (Fragment) OS=Homo sapiens OX=9606 GN=DNAJA3 PE=2 SV=1
2	AFDB:A0A0G2K5E4	0.731	0.731	2.008E-80	480	0.875	0.875	A0A0G2K5E4.pdb.gz	A0A0G2K5E4_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=3 SV=1
3	AFDB:G3V6I5	0.384	0.427	1.451E-60	429	0.773	0.865	G3V6I5.pdb.gz	G3V6I5_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=1 SV=2
4	AFDB:Q27237	0.506	0.469	7.933E-52	520	0.450	0.415	Q27237.pdb.gz	TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG5504 PE=1 SV=2
5	AFDB:Q8TA83	0.485	0.504	6.587E-46	456	0.358	0.377	Q8TA83.pdb.gz	DNJ10_CAEEL DnaJ homolog dnj-10 OS=Caenorhabditis elegans OX=6239 GN=dnj-10 PE=3 SV=1
6	AFDB:Q8GWW8	0.473	0.492	8.807E-43	456	0.302	0.318	Q8GWW8.pdb.gz	GFA2_ARATH Chaperone protein dnaJ GFA2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GFA2 PE=2 SV=1
7	AFDB:P08622	0.409	0.506	1.251E-40	376	0.260	0.332	P08622.pdb.gz	DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) OX=83333 GN=dnaJ PE=1 SV=3
8	AFDB:Q0WN54	0.364	0.351	1.178E-39	500	0.304	0.292	Q0WN54.pdb.gz	Q0WN54_ARATH Molecular chaperone Hsp40/DnaJ family protein OS=Arabidopsis thaliana OX=3702 GN=DJA7 PE=1 SV=1
9	AFDB:P87239	0.390	0.358	1.406E-39	528	0.302	0.275	P87239.pdb.gz	MDJ1_SCHPO DnaJ homolog 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdj1 PE=3 SV=1
10	AFDB:Q940V1	0.450	0.477	4.065E-39	447	0.279	0.300	Q940V1.pdb.gz	Q940V1_ARATH AT4g39960/T5J17_130 OS=Arabidopsis thaliana OX=3702 GN=DJA5 PE=1 SV=1
11	PDB:6byrA	0.138	0.163	3.001E-4	405	0.079	0.094	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.133	0.238	1.097E-2	262	0.062	0.115	7x3kA.pdb.gz
13	PDB:5y88T	0.115	0.445	1.235E-2	107	0.050	0.224	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
14	PDB:7sqcO1	0.124	0.096	1.759E-2	673	0.079	0.056	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:2y4uA	0.116	0.131	2.821E-2	424	0.067	0.075	2y4uA.pdb.gz
16	PDB:1fpoA	0.119	0.317	4.019E-2	171	0.027	0.076	1fpoA.pdb.gz
17	PDB:2l6lA	0.112	0.296	4.522E-2	155	0.069	0.213	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
18	PDB:7sqcO0	0.115	0.063	4.257E-1	1140	0.073	0.031	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:5apnh	0.112	0.357	4.515E-1	119	0.033	0.134	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
20	PDB:7ea3J	0.078	0.052	5.081E-1	883	0.085	0.046	7ea3J.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K4Y1	0.0	820	453	0.817	0.865	A0A0G2K4Y1_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=3 SV=1
2	A0A0G2K5E4	0.0	874	480	0.875	0.875	A0A0G2K5E4_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=3 SV=1
3	G3V6I5	0.0	743	429	0.775	0.867	G3V6I5_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=1 SV=2
4	Q2TVU3	0.0	818	453	0.817	0.865	Q2TVU3_RAT TID1 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=2 SV=1
5	Q2UZS7	0.0	872	480	0.875	0.875	Q2UZS7_RAT Tid-1 long isoform OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=2 SV=1
6	Q53G26	0.0	996	480	1.000	1.000	Q53G26_HUMAN DnaJ (Hsp40) homolog, subfamily A, member 3 variant (Fragment) OS=Homo sapiens OX=9606 GN=DNAJA3 PE=2 SV=1
7	Q96EY1	0.0	996	480	1.000	1.000	DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3 PE=1 SV=2
8	Q99M87	0.0	871	480	0.875	0.875	DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus OX=10090 GN=Dnaja3 PE=1 SV=1
9	Q27237	1.42e-130	390	520	0.415	0.383	TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG5504 PE=1 SV=2
10	Q8TA83	8.34e-93	291	456	0.329	0.346	DNJ10_CAEEL DnaJ homolog dnj-10 OS=Caenorhabditis elegans OX=6239 GN=dnj-10 PE=3 SV=1
11	Q8GWW8	3.07e-81	261	456	0.300	0.316	GFA2_ARATH Chaperone protein dnaJ GFA2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GFA2 PE=2 SV=1
12	P08622	2.87e-71	232	376	0.258	0.330	DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) OX=83333 GN=dnaJ PE=1 SV=3
13	Q9SJZ7	7.53e-66	220	442	0.269	0.292	DNJA6_ARATH Chaperone protein dnaJ A6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DJA6 PE=2 SV=2
14	Q058J9	2.81e-62	213	517	0.263	0.244	Q058J9_ARATH At3g17830 OS=Arabidopsis thaliana OX=3702 GN=DJA4 PE=1 SV=1
15	Q940V1	5.01e-62	210	447	0.277	0.298	Q940V1_ARATH AT4g39960/T5J17_130 OS=Arabidopsis thaliana OX=3702 GN=DJA5 PE=1 SV=1
16	Q0WN54	1.94e-60	207	500	0.265	0.254	Q0WN54_ARATH Molecular chaperone Hsp40/DnaJ family protein OS=Arabidopsis thaliana OX=3702 GN=DJA7 PE=1 SV=1
17	P87239	1.10e-57	201	528	0.275	0.250	MDJ1_SCHPO DnaJ homolog 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdj1 PE=3 SV=1
18	Q9U0J2	2.10e-55	197	672	0.246	0.176	Q9U0J2_PLAF7 Chaperone protein DnaJ OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0409400 PE=3 SV=1
19	P95830	1.16e-53	186	378	0.269	0.341	DNAJ_STRPN Chaperone protein DnaJ OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=dnaJ PE=1 SV=2
20	P9WNV7	9.15e-49	173	382	0.240	0.301	DNAJ2_MYCTU Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dnaJ2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	2e-24	96.8	DnaJ domain
2	PF01556 DnaJ_C	1.7e-21	88.3	DnaJ C terminal domain
3	PF00684 DnaJ_CXXCXGXG	1e-08	46.6	DnaJ central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297185	0.998	Stress-70 protein, mitochondrial
2	9606.ENSP00000302961	0.997	Heat shock protein family A member 4
3	9606.ENSP00000364802	0.992	Heat shock 70 kDa protein 1A
4	9606.ENSP00000432083	0.971	Heat shock cognate 71 kDa protein
5	9606.ENSP00000371067	0.968	Tyrosine-protein kinase JAK2
6	9606.ENSP00000264954	0.955	GrpE protein homolog 1, mitochondrial
7	9606.ENSP00000431418	0.950	High affinity nerve growth factor receptor
8	9606.ENSP00000229135	0.942	Interferon gamma
9	9606.ENSP00000332353	0.942	Protein patched homolog 1
10	9606.ENSP00000269305	0.940	Cellular tumor antigen p53
11	9606.ENSP00000270538	0.926	Mitochondrial import inner membrane translocase subunit TIM44
12	9606.ENSP00000372088	0.908	DNA repair protein RAD51 homolog 1
13	9606.ENSP00000331327	0.901	Wilms tumor protein
14	9606.ENSP00000358525	0.901	Beta-nerve growth factor
15	9606.ENSP00000267163	0.900	Retinoblastoma-associated protein
16	9606.ENSP00000356713	0.900	Interferon gamma receptor 1
17	9606.ENSP00000373620	0.884	60 kDa heat shock protein, mitochondrial
18	9606.ENSP00000275493	0.878	Epidermal growth factor receptor
19	9606.ENSP00000296464	0.878	Heat shock 70 kDa protein 4L
20	9606.ENSP00000318687	0.872	Heat shock protein 105 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0031072	0.984	heat shock protein binding
GO:0030544	0.960	Hsp70 protein binding
GO:0098772	0.526	molecular function regulator activity
GO:0051082	0.436	unfolded protein binding
GO:0140677	0.305	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0080090	0.970	regulation of primary metabolic process
GO:0065009	0.968	regulation of molecular function
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0031323	0.966	regulation of cellular metabolic process
GO:0048523	0.959	negative regulation of cellular process
GO:0050896	0.943	response to stimulus
GO:0051090	0.941	regulation of DNA-binding transcription factor activity
GO:0044092	0.912	negative regulation of molecular function
GO:0043433	0.903	negative regulation of DNA-binding transcription factor activity
GO:0032088	0.879	negative regulation of NF-kappaB transcription factor activity
GO:0048518	0.872	positive regulation of biological process
GO:0071840	0.860	cellular component organization or biogenesis
GO:0048522	0.857	positive regulation of cellular process
GO:0016043	0.845	cellular component organization
GO:0002682	0.828	regulation of immune system process
GO:0006950	0.684	response to stress
GO:0044238	0.561	primary metabolic process
GO:0071704	0.553	organic substance metabolic process
GO:0044237	0.536	cellular metabolic process
GO:0006807	0.493	nitrogen compound metabolic process
GO:0051716	0.482	cellular response to stimulus
GO:0043170	0.450	macromolecule metabolic process
GO:0009893	0.450	positive regulation of metabolic process
GO:0010941	0.441	regulation of cell death
GO:0042221	0.421	response to chemical
GO:0043067	0.420	regulation of programmed cell death
GO:0010604	0.419	positive regulation of macromolecule metabolic process
GO:0006996	0.413	organelle organization
GO:0002376	0.403	immune system process
GO:0032501	0.378	multicellular organismal process
GO:0032502	0.376	developmental process
GO:0006457	0.347	protein folding
GO:0010033	0.319	response to organic substance
GO:0042127	0.319	regulation of cell population proliferation
GO:0007154	0.314	cell communication
GO:0048583	0.313	regulation of response to stimulus
GO:0023052	0.308	signaling
GO:0051173	0.307	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005829	0.922	cytosol
GO:0016020	0.867	membrane
GO:0005634	0.850	nucleus
GO:0005759	0.572	mitochondrial matrix
GO:0031981	0.355	nuclear lumen
GO:0009295	0.328	nucleoid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]