StarFunc result for job id Q96EY7

User Input

>input (689 residues)
MAVVSAVRWLGLRSRLGQPLTGRRAGLCEQARSCRFYSGSATLSKVEGTDVTGIEEVVIP
KKKTWDKVAVLQALASTVNRDTTAVPYVFQDDPYLMPASSLESRSFLLAKKSGENVAKFI
INSYPKYFQKDIAEPHIPCLMPEYFEPQIKDISEAALKERIELRKVKASVDMFDQLLQAG
TTVSLETTNSLLDLLCYYGDQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRA
KNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHADVYTFNALIEA
TVCAINEKFEEKWSKILELLRHMVAQKVKPNLQTFNTILKCLRRFHVFARSPALQVLREM
KAIGIEPSLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAM
SICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYED
LIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKH
PPELQVAFADCAADIKSAYESQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFR
KHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQK
EALSNLTALTSDSDTDSSSDSDSDTSEGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EY7	1.000	1.000	6.133E-84	689	1.000	1.000	Q96EY7.pdb.gz	PTCD3_HUMAN Small ribosomal subunit protein mS39 OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3
2	AFDB:Q2KI62	0.869	0.870	2.165E-66	688	0.788	0.789	Q2KI62.pdb.gz	PTCD3_BOVIN Small ribosomal subunit protein mS39 OS=Bos taurus OX=9913 GN=PTCD3 PE=1 SV=1
3	AFDB:Q14C51	0.870	0.875	5.427E-64	685	0.734	0.739	Q14C51.pdb.gz	PTCD3_MOUSE Small ribosomal subunit protein mS39 OS=Mus musculus OX=10090 GN=Ptcd3 PE=1 SV=2
4	PDB:7po24	0.841	0.977	9.686E-64	592	0.856	0.997	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
5	PDB:7pnt4	0.824	0.960	9.999E-55	589	0.665	0.778	7pnt4.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
6	PDB:6zs9A4	0.767	0.940	1.532E-45	558	0.807	0.996	6zs9A4.pdb.gz	Structural basis of mitochondrial translation.
7	AFDB:A1Z9A8	0.795	0.837	6.109E-33	652	0.283	0.299	A1Z9A8.pdb.gz	PTCD3_DROME Small ribosomal subunit protein mS39 OS=Drosophila melanogaster OX=7227 GN=CG4679 PE=2 SV=1
8	PDB:7a5fe6	0.528	0.855	2.264E-25	414	0.586	0.976	7a5fe6.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
9	AFDB:Q9ZUU3	0.499	0.461	7.310E-12	757	0.148	0.135	Q9ZUU3.pdb.gz	PP190_ARATH Large ribosomal subunit protein mL102 (rPPR5) OS=Arabidopsis thaliana OX=3702 GN=At2g37230 PE=2 SV=1
10	AFDB:Q9SXD1	0.309	0.333	1.028E-10	630	0.132	0.144	Q9SXD1.pdb.gz	PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g62670 PE=3 SV=2
11	AFDB:Q9S7Q2	0.463	0.382	1.113E-10	862	0.139	0.111	Q9S7Q2.pdb.gz	PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC2 PE=2 SV=1
12	AFDB:P0C7Q7	0.318	0.356	1.303E-10	602	0.125	0.143	P0C7Q7.pdb.gz	PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12700 PE=3 SV=1
13	AFDB:Q9FMQ1	0.290	0.249	1.467E-10	816	0.142	0.120	Q9FMQ1.pdb.gz	PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g12100 PE=2 SV=1
14	AFDB:Q9SXD8	0.332	0.357	1.467E-10	634	0.119	0.129	Q9SXD8.pdb.gz	PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana OX=3702 GN=At1g62590 PE=2 SV=1
15	PDB:4m57A	0.319	0.314	1.856E-8	702	0.113	0.111	4m57A.pdb.gz
16	PDB:6xywAO	0.243	0.342	3.767E-5	452	0.102	0.155	6xywAO.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
17	PDB:6sgaF7	0.332	0.342	1.826E-4	662	0.099	0.103	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:6tedQ	0.207	0.174	3.864E-4	890	0.096	0.074	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:6yxxE6	0.285	0.416	6.713E-4	434	0.071	0.113	6yxxE6.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
20	PDB:6sgaFA	0.234	0.265	7.861E-4	579	0.103	0.123	6sgaFA.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14C51	0.0	993	685	0.717	0.721	PTCD3_MOUSE Small ribosomal subunit protein mS39 OS=Mus musculus OX=10090 GN=Ptcd3 PE=1 SV=2
2	Q2KI62	0.0	1106	688	0.768	0.769	PTCD3_BOVIN Small ribosomal subunit protein mS39 OS=Bos taurus OX=9913 GN=PTCD3 PE=1 SV=1
3	Q96EY7	0.0	1440	689	1.000	1.000	PTCD3_HUMAN Small ribosomal subunit protein mS39 OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3
4	A1Z9A8	7.37e-88	290	652	0.290	0.307	PTCD3_DROME Small ribosomal subunit protein mS39 OS=Drosophila melanogaster OX=7227 GN=CG4679 PE=2 SV=1
5	Q9LQ16	2.45e-10	66.2	632	0.091	0.100	PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana OX=3702 GN=At1g62910 PE=2 SV=1
6	Q0WKV3	1.66e-09	63.5	637	0.077	0.083	PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12300 PE=2 SV=1
7	Q9T0D6	4.95e-09	61.6	566	0.075	0.092	PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana OX=3702 GN=At4g11690 PE=2 SV=1
8	Q9SXD8	7.29e-09	61.2	634	0.087	0.095	PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana OX=3702 GN=At1g62590 PE=2 SV=1
9	P0C7Q7	1.17e-08	60.5	602	0.081	0.093	PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12700 PE=3 SV=1
10	Q389W1	2.68e-08	59.3	458	0.065	0.098	Q389W1_TRYB2 Pentacotripeptide-repeat region of PRORP domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0120 PE=4 SV=1
11	Q9S7Q2	3.96e-08	59.3	862	0.058	0.046	PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC2 PE=2 SV=1
12	Q9LQ14	4.07e-08	58.9	629	0.057	0.062	PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g62930 PE=2 SV=2
13	Q9FIX3	1.31e-07	57.4	747	0.091	0.084	PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana OX=3702 GN=EMB2745 PE=2 SV=1
14	Q9SUD8	1.69e-07	57.0	704	0.102	0.099	PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana OX=3702 GN=At4g28010 PE=2 SV=1
15	O49436	2.72e-07	56.2	660	0.110	0.115	PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana OX=3702 GN=EMB1025 PE=3 SV=1
16	Q9SXD1	4.20e-07	55.8	630	0.090	0.098	PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g62670 PE=3 SV=2
17	Q9FMQ1	4.49e-07	55.8	816	0.060	0.050	PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g12100 PE=2 SV=1
18	O64624	4.83e-07	55.5	822	0.084	0.071	PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g18940 PE=2 SV=1
19	Q9SI78	4.93e-07	55.1	485	0.046	0.066	PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana OX=3702 GN=At1g62720 PE=2 SV=1
20	B8Y6I0	5.54e-07	55.5	786	0.048	0.042	PPR10_MAIZE Pentatricopeptide repeat-containing protein 10, chloroplastic OS=Zea mays OX=4577 GN=PPR10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18723 aGPT-Pplase1	1.3e+02	13.4	alpha-glutamyl/putrescinyl thymine pyrophosphorylase clade 1
2	PF01535 PPR	0.77	21.2	PPR repeat
3	PF12854 PPR_1	0.022	25.8	PPR repeat
4	PF13041 PPR_2	1e-18	78.6	PPR repeat family
5	PF13812 PPR_3	2.2e-10	51.8	Pentatricopeptide repeat domain
6	PF17177 PPR_long	6.3e-05	33.9	Pentacotripeptide-repeat region of PRORP
7	PF08579 RPM2	1.3	20.8	Mitochondrial ribonuclease P subunit (RPM2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254630

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272418	0.997	Belongs to the universal ribosomal protein uS5 family.
2	9606.ENSP00000315397	0.997	Mitochondrial ribosomal protein S31
3	9606.ENSP00000357320	0.997	28S ribosomal protein S29, mitochondrial
4	9606.ENSP00000360850	0.996	Mitochondrial ribosomal protein S2
5	9606.ENSP00000258455	0.995	Mitochondrial ribosomal protein S9
6	9606.ENSP00000317376	0.995	Mitochondrial ribosomal protein S11
7	9606.ENSP00000320184	0.994	Mitochondrial ribosomal protein S23
8	9606.ENSP00000259873	0.993	Mitochondrial ribosomal protein S18B
9	9606.ENSP00000426941	0.993	28S ribosomal protein S27, mitochondrial
10	9606.ENSP00000418008	0.992	Mitochondrial ribosomal protein S22
11	9606.ENSP00000081029	0.990	Mitochondrial ribosomal protein S35
12	9606.ENSP00000362208	0.989	Mitochondrial ribosomal protein S15
13	9606.ENSP00000276585	0.988	Mitochondrial ribosomal protein S28
14	9606.ENSP00000053468	0.985	Mitochondrial ribosomal protein S10
15	9606.ENSP00000361923	0.985	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
16	9606.ENSP00000370508	0.983	Translation initiation factor IF-3, mitochondrial
17	9606.ENSP00000177742	0.982	28S ribosomal protein S34, mitochondrial
18	9606.ENSP00000245539	0.981	Mitochondrial ribosomal protein S7
19	9606.ENSP00000342676	0.981	Aurora kinase A-interacting protein
20	9606.ENSP00000461930	0.978	Mitochondrial ribosomal protein S21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043024	1.000	ribosomal small subunit binding
GO:0019843	1.000	rRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006412	0.986	translation
GO:0140053	0.965	mitochondrial gene expression
GO:0032543	0.938	mitochondrial translation
GO:0065007	0.333	biological regulation
GO:0050789	0.323	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.996	mitochondrial membrane
GO:0070013	0.986	intracellular organelle lumen
GO:0019866	0.977	organelle inner membrane
GO:0005743	0.945	mitochondrial inner membrane
GO:0032991	0.871	protein-containing complex
GO:0031981	0.838	nuclear lumen
GO:0005759	0.808	mitochondrial matrix
GO:0098798	0.747	mitochondrial protein-containing complex
GO:0005654	0.626	nucleoplasm
GO:0005829	0.543	cytosol
GO:0005886	0.536	plasma membrane
GO:0043232	0.462	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]