StarFunc result for job id Q96EY8

User Input

>input (250 residues)
MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYT
KTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCT
LQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISS
ALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMK
NDPSAESEGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2R6J3	0.822	0.822	1.125E-35	250	0.992	0.992	B2R6J3.pdb.gz	B2R6J3_HUMAN cDNA, FLJ92974, highly similar to Homo sapiens methylmalonic aciduria (cobalamin deficiency) type B(MMAB), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:Q58D49	0.838	0.867	4.627E-32	241	0.824	0.855	Q58D49.pdb.gz	MMAB_BOVIN Corrinoid adenosyltransferase MMAB OS=Bos taurus OX=9913 GN=MMAB PE=1 SV=1
3	AFDB:Q9D273	0.785	0.825	2.297E-31	237	0.804	0.848	Q9D273.pdb.gz	MMAB_MOUSE Corrinoid adenosyltransferase MMAB OS=Mus musculus OX=10090 GN=Mmab PE=1 SV=1
4	PDB:3ci1A	0.684	0.903	1.787E-13	188	0.292	0.388	3ci1A.pdb.gz	Structural characterization of a human-type corrinoid adenosyltransferase confirms that coenzyme B12 is synthesized through a four-coordinate intermediate.
5	AFDB:Q50EJ2	0.692	0.912	2.196E-13	188	0.292	0.388	Q50EJ2.pdb.gz	Q50EJ2_LIMRT Corrinoid adenosyltransferase OS=Limosilactobacillus reuteri OX=1598 GN=cobA PE=1 SV=1
6	AFDB:Q1LJ80	0.669	0.899	9.075E-12	184	0.276	0.375	Q1LJ80.pdb.gz	ATR_CUPMC Cobalamin adenosyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=cobO PE=1 SV=1
7	AFDB:Q8ZNR5	0.628	0.473	2.612E-10	336	0.244	0.182	Q8ZNR5.pdb.gz	PDUO_SALTY Corrinoid adenosyltransferase PduO OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=pduO PE=1 SV=1
8	AFDB:Q9UJA2	0.198	0.168	4.520E-2	301	0.140	0.116	Q9UJA2.pdb.gz	CRLS1_HUMAN Cardiolipin synthase (CMP-forming) OS=Homo sapiens OX=9606 GN=CRLS1 PE=1 SV=1
9	AFDB:Q80ZM8	0.179	0.157	8.405E-2	303	0.144	0.119	Q80ZM8.pdb.gz	CRLS1_MOUSE Cardiolipin synthase (CMP-forming) OS=Mus musculus OX=10090 GN=Crls1 PE=1 SV=1
10	AFDB:Q06677	0.138	0.062	1.146E-1	668	0.112	0.042	Q06677.pdb.gz	SWA2_YEAST Auxilin-like clathrin uncoating factor SWA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWA2 PE=1 SV=1
11	AFDB:Q57X11	0.175	0.060	1.563E-1	918	0.128	0.035	Q57X11.pdb.gz	Q57X11_TRYB2 Recombination initiation protein NBS1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.400 PE=4 SV=1
12	PDB:1huwA	0.221	0.305	5.134E-1	166	0.072	0.108	1huwA.pdb.gz
13	PDB:1lw1A	0.188	0.244	7.373E-1	175	0.100	0.143	1lw1A.pdb.gz
14	PDB:5jxdA	0.193	0.236	9.547E-1	186	0.092	0.124	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
15	PDB:3d48P	0.223	0.298	1.005	165	0.084	0.127	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
16	PDB:1t72A	0.196	0.224	1.059	215	0.096	0.112	1t72A.pdb.gz
17	PDB:4ej4A	0.122	0.094	1.059	442	0.088	0.050	4ej4A.pdb.gz	Structure of the delta opioid receptor bound to naltrindole
18	PDB:6dftA	0.138	0.098	1.059	384	0.040	0.026	6dftA.pdb.gz	Trypanosomatid Deoxyhypusine Synthase Activity Is Dependent on Shared Active-Site Complementation between Pseudoenzyme Paralogs.
19	PDB:1jqnA	0.139	0.048	1.520	874	0.096	0.027	1jqnA.pdb.gz	Crystal structures of C4 form maize and quaternary complex of E. coli phosphoenolpyruvate carboxylases.
20	PDB:7eivB	0.159	0.137	1.601	300	0.060	0.050	7eivB.pdb.gz	X-shaped structure of bacterial heterotetrameric tRNA synthetase suggests cryptic prokaryote functions and a rationale for synthetase classifications.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2R6J3	0.0	511	250	0.992	0.992	B2R6J3_HUMAN cDNA, FLJ92974, highly similar to Homo sapiens methylmalonic aciduria (cobalamin deficiency) type B(MMAB), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	Q96EY8	0.0	515	250	1.000	1.000	MMAB_HUMAN Corrinoid adenosyltransferase MMAB OS=Homo sapiens OX=9606 GN=MMAB PE=1 SV=1
3	Q58D49	6.97e-147	411	241	0.792	0.822	MMAB_BOVIN Corrinoid adenosyltransferase MMAB OS=Bos taurus OX=9913 GN=MMAB PE=1 SV=1
4	Q9D273	1.42e-142	400	237	0.776	0.819	MMAB_MOUSE Corrinoid adenosyltransferase MMAB OS=Mus musculus OX=10090 GN=Mmab PE=1 SV=1
5	Q50EJ2	5.13e-38	133	188	0.288	0.383	Q50EJ2_LIMRT Corrinoid adenosyltransferase OS=Limosilactobacillus reuteri OX=1598 GN=cobA PE=1 SV=1
6	Q1LJ80	5.24e-30	112	184	0.292	0.397	ATR_CUPMC Cobalamin adenosyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=cobO PE=1 SV=1
7	Q8ZNR5	2.56e-21	93.2	336	0.252	0.188	PDUO_SALTY Corrinoid adenosyltransferase PduO OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=pduO PE=1 SV=1
8	P56657	0.81	33.1	491	0.124	0.063	CP240_MOUSE Cytochrome P450 2C40 OS=Mus musculus OX=10090 GN=Cyp2c40 PE=1 SV=2
9	P54888	6.0	30.8	726	0.072	0.025	P5CS2_ARATH Delta-1-pyrroline-5-carboxylate synthase B OS=Arabidopsis thaliana OX=3702 GN=P5CSB PE=2 SV=1
10	Q566X7	7.5	30.0	307	0.080	0.065	Q566X7_DANRE Nucleophosmin (Fragment) OS=Danio rerio OX=7955 GN=npm4 PE=2 SV=1
11	Q381Z9	9.7	30.0	643	0.060	0.023	Q381Z9_TRYB2 Kinetoplast polyadenylation/uridylation factor 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5980 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01923 Cob_adeno_trans	1.4e-54	196.3	Cobalamin adenosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445920

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281317	0.968	Methylmalonic aciduria type A protein, mitochondrial
2	9606.ENSP00000274813	0.960	Methylmalonyl-CoA mutase, mitochondrial
3	9606.ENSP00000389060	0.944	Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
4	9606.ENSP00000264668	0.917	Methionine synthase reductase
5	9606.ENSP00000359609	0.901	Probable lysosomal cobalamin transporter
6	9606.ENSP00000383840	0.896	Methylmalonic aciduria and homocystinuria type C protein
7	9606.ENSP00000244217	0.801	Methylmalonyl-CoA epimerase, mitochondrial
8	9606.ENSP00000419027	0.761	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
9	9606.ENSP00000443551	0.743	Mevalonate kinase
10	9606.ENSP00000264033	0.739	E3 ubiquitin-protein ligase CBL
11	9606.ENSP00000301458	0.726	CD320 antigen
12	9606.ENSP00000479130	0.721	Acyl-CoA synthetase family member 3, mitochondrial
13	9606.ENSP00000365462	0.708	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
14	9606.ENSP00000355632	0.698	Polypeptide N-acetylgalactosaminyltransferase 2
15	9606.ENSP00000355536	0.689	Methionine synthase
16	9606.ENSP00000312150	0.644	Tribbles homolog 1
17	9606.ENSP00000395196	0.640	Probable glutamate--tRNA ligase, mitochondrial
18	9606.ENSP00000403910	0.634	Distal membrane-arm assembly complex protein 2
19	9606.ENSP00000329360	0.632	Coiled-coil domain containing 137
20	9606.ENSP00000357787	0.613	Uroporphyrinogen-III synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016740	0.997	transferase activity
GO:0016765	0.987	transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0097159	0.913	organic cyclic compound binding
GO:1901363	0.903	heterocyclic compound binding
GO:0046906	0.679	tetrapyrrole binding
GO:0008817	0.565	corrinoid adenosyltransferase activity
GO:0036094	0.548	small molecule binding
GO:0019842	0.405	vitamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006807	0.963	nitrogen compound metabolic process
GO:1901564	0.930	organonitrogen compound metabolic process
GO:1901360	0.888	organic cyclic compound metabolic process
GO:0044281	0.887	small molecule metabolic process
GO:0046483	0.884	heterocycle metabolic process
GO:0006725	0.884	cellular aromatic compound metabolic process
GO:0033013	0.813	tetrapyrrole metabolic process
GO:0006767	0.769	water-soluble vitamin metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.987	mitochondrial matrix
GO:0031981	0.421	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.
EC:2.5.1.-	0.987	Transferring alkyl or aryl groups, other than methyl groups.
EC:2.5.1.17	0.565	corrinoid adenosyltransferase.

[back to server]