StarFunc result for job id Q96EZ8

User Input

>input (462 residues)
MDKDSQGLLDSSLMASGTASRSEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDE
LVESSLAKSSTRAKGASGVEPGRCSGSEPSSSEKKKVSKAPSTPVPPSPAPAPGLTKRVK
KSKQPLQVTKDLGRWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFTLREVQERWYALLY
DPVISKLACQAMRQLHPEAIAAIQSKALFSKAEEQLLSKVGSTSQPTLETFQDLLHRHPD
AFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEV
LEHELMVADRRQKREIRQLEQELHKWQVLVDSITGMSSPDFDNQTLAVLRGRMVRYLMRS
REITLGRATKDNQIDVDLSLEGPAWKISRKQGVIKLKNNGDFFIANEGRRPIYIDGRPVL
CGSKWRLSNNSVVEIASLRFVFLINQDLIALIRAEAAKITPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V9E0	0.367	0.367	9.715E-72	462	0.987	0.987	G3V9E0.pdb.gz	G3V9E0_RAT Microspherule protein 1 OS=Rattus norvegicus OX=10116 GN=Mcrs1 PE=1 SV=1
2	AFDB:Q9M2V2	0.280	0.188	3.735E-13	735	0.165	0.103	Q9M2V2.pdb.gz	Q9M2V2_ARATH Uncharacterized protein T12E18_40 OS=Arabidopsis thaliana OX=3702 GN=T12E18_40 PE=1 SV=1
3	AFDB:F4HZ48	0.255	0.216	7.175E-11	555	0.197	0.164	F4HZ48.pdb.gz	F4HZ48_ARATH Forkhead-associated (FHA) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g75530 PE=4 SV=1
4	PDB:2ff4A	0.189	0.228	1.068E-7	379	0.115	0.140	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
5	PDB:2kb3A	0.178	0.535	1.381E-5	143	0.054	0.175	2kb3A.pdb.gz
6	PDB:7dvqX	0.188	0.524	3.820E-5	156	0.032	0.096	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
7	PDB:2kfuA	0.183	0.470	1.758E-4	162	0.065	0.185	2kfuA.pdb.gz
8	PDB:7wrgB	0.175	0.106	2.924E-4	783	0.061	0.036	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
9	PDB:7wrgA	0.181	0.107	3.666E-4	812	0.069	0.039	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
10	PDB:5gm6U	0.189	0.462	7.225E-4	176	0.041	0.108	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
11	PDB:6l9wD	0.156	0.481	8.090E-4	142	0.032	0.106	6l9wD.pdb.gz
12	AFDB:B1AK66	0.182	0.211	1.187E-3	396	0.119	0.139	B1AK66.pdb.gz	B1AK66_HUMAN Smad nuclear interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=2 SV=1
13	PDB:5z56X	0.175	0.457	4.939E-3	159	0.028	0.082	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	AFDB:E9QIC8	0.093	0.055	8.589E-3	1025	0.130	0.059	E9QIC8.pdb.gz	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
15	AFDB:P53924	0.177	0.160	4.683E-2	522	0.108	0.096	P53924.pdb.gz	DMA2_YEAST E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DMA2 PE=1 SV=1
16	AFDB:Q6P1I6	0.121	0.086	4.956E-2	770	0.134	0.081	Q6P1I6.pdb.gz	PSD2_MOUSE PH and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Psd2 PE=1 SV=1
17	AFDB:A0A2R8Y739	0.101	0.123	5.244E-2	361	0.106	0.136	A0A2R8Y739.pdb.gz	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
18	AFDB:Q9VLX2	0.074	0.049	6.213E-2	861	0.123	0.066	Q9VLX2.pdb.gz	Q9VLX2_DROME Bromodomain containing 7/9 OS=Drosophila melanogaster OX=7227 GN=Brd7-9 PE=1 SV=1
19	AFDB:P14599	0.081	0.045	7.790E-2	887	0.139	0.072	P14599.pdb.gz	A4_DROME Amyloid-beta-like protein OS=Drosophila melanogaster OX=7227 GN=Appl PE=1 SV=2
20	PDB:6iczL	0.088	0.090	1.311E-1	454	0.078	0.079	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A524	0.0	907	462	0.965	0.965	A0A8I6A524_RAT Microspherule protein 1 OS=Rattus norvegicus OX=10116 GN=Mcrs1 PE=1 SV=1
2	F8W126	0.0	647	318	0.688	1.000	F8W126_HUMAN Microspherule protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=MCRS1 PE=1 SV=1
3	G3V9E0	0.0	932	462	0.987	0.987	G3V9E0_RAT Microspherule protein 1 OS=Rattus norvegicus OX=10116 GN=Mcrs1 PE=1 SV=1
4	Q5BJR5	0.0	930	462	0.985	0.985	Q5BJR5_RAT Microspherule protein 1 OS=Rattus norvegicus OX=10116 GN=Mcrs1 PE=2 SV=1
5	Q6P0E3	0.0	696	472	0.777	0.761	Q6P0E3_DANRE Microspherule protein 1 OS=Danio rerio OX=7955 GN=wu:fj97a11 PE=1 SV=1
6	Q96EZ8	0.0	944	462	1.000	1.000	MCRS1_HUMAN Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1 PE=1 SV=1
7	Q99L90	0.0	929	462	0.983	0.983	MCRS1_MOUSE Microspherule protein 1 OS=Mus musculus OX=10090 GN=Mcrs1 PE=1 SV=1
8	Q9VZJ3	3.08e-144	426	578	0.506	0.405	Q9VZJ3_DROME GH01794p OS=Drosophila melanogaster OX=7227 GN=Rcd5 PE=1 SV=1
9	Q9M2V2	8.18e-16	82.4	735	0.115	0.072	Q9M2V2_ARATH Uncharacterized protein T12E18_40 OS=Arabidopsis thaliana OX=3702 GN=T12E18_40 PE=1 SV=1
10	F4HZ48	5.46e-11	67.0	555	0.110	0.092	F4HZ48_ARATH Forkhead-associated (FHA) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g75530 PE=4 SV=1
11	O60129	0.001	44.3	642	0.093	0.067	FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fkh2 PE=1 SV=1
12	Q9SFV6	0.005	40.8	251	0.067	0.124	FHA1_ARATH FHA domain-containing protein FHA1 OS=Arabidopsis thaliana OX=3702 GN=FHA1 PE=2 SV=1
13	Q945P0	0.019	38.9	209	0.065	0.144	FHA1_TOBAC Transcriptional activator FHA1 OS=Nicotiana tabacum OX=4097 GN=FHA1 PE=1 SV=1
14	Q9SFV2	0.023	39.3	320	0.067	0.097	FHA2_ARATH FHA domain-containing protein FHA2 OS=Arabidopsis thaliana OX=3702 GN=FHA2 PE=1 SV=1
15	Q3UCQ1	0.031	39.3	651	0.052	0.037	FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus OX=10090 GN=Foxk2 PE=1 SV=3
16	P85037	0.040	38.9	733	0.043	0.027	FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1
17	P42128	0.042	38.9	719	0.043	0.028	FOXK1_MOUSE Forkhead box protein K1 OS=Mus musculus OX=10090 GN=Foxk1 PE=1 SV=2
18	Q01167	0.066	38.1	660	0.052	0.036	FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3
19	O14270	0.15	37.0	743	0.063	0.039	FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fhl1 PE=3 SV=2
20	Q9DE49	0.86	34.7	1059	0.039	0.017	PGFRA_DANRE Platelet-derived growth factor receptor alpha OS=Danio rerio OX=7955 GN=pdgfra PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	0.1	24.2	FHA domain
2	PF13325 MCRS_N	2.1e-90	313.5	N-terminal region of micro-spherule protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000002402

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000006361	0.971	PHD finger protein 20
2	60711.ENSCSAP00000013386	0.953	KAT8 regulatory NSL complex subunit 3
3	60711.ENSCSAP00000002552	0.945	KAT8 regulatory NSL complex subunit 2
4	60711.ENSCSAP00000000146	0.939	KAT8 regulatory NSL complex subunit 1
5	60711.ENSCSAP00000002043	0.925	K(lysine) acetyltransferase 8
6	60711.ENSCSAP00000002452	0.900	INO80 complex subunit E
7	60711.ENSCSAP00000011668	0.897	WD repeat domain 5
8	60711.ENSCSAP00000015277	0.861	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
9	60711.ENSCSAP00000003896	0.858	INO80 complex subunit
10	60711.ENSCSAP00000013512	0.845	Testis expressed 30
11	60711.ENSCSAP00000013929	0.802	INO80 complex subunit C
12	60711.ENSCSAP00000005828	0.788	Death-domain associated protein
13	60711.ENSCSAP00000004850	0.783	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
14	60711.ENSCSAP00000010046	0.777	ARP5 actin-related protein 5 homolog (yeast)
15	60711.ENSCSAP00000015829	0.776	Nuclear factor related to kappaB binding protein
16	60711.ENSCSAP00000003094	0.770	Host cell factor C1
17	60711.ENSCSAP00000006488	0.757	INO80 complex subunit D
18	60711.ENSCSAP00000006608	0.751	YY1 transcription factor
19	60711.ENSCSAP00000003179	0.735	Uncharacterized protein
20	60711.ENSCSAP00000006661	0.735	Chromodomain helicase DNA binding protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.826	organic cyclic compound binding
GO:1901363	0.825	heterocyclic compound binding
GO:0003676	0.822	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.985	cellular process
GO:0051173	0.985	positive regulation of nitrogen compound metabolic process
GO:0010604	0.985	positive regulation of macromolecule metabolic process
GO:0031325	0.985	positive regulation of cellular metabolic process
GO:0045935	0.983	positive regulation of nucleobase-containing compound metabolic process
GO:0032204	0.982	regulation of telomere maintenance
GO:0016043	0.969	cellular component organization
GO:0018205	0.949	peptidyl-lysine modification
GO:0006473	0.945	protein acetylation
GO:0018394	0.940	peptidyl-lysine acetylation
GO:0010468	0.936	regulation of gene expression
GO:0016570	0.935	histone modification
GO:0006475	0.895	internal protein amino acid acetylation
GO:0006355	0.883	regulation of DNA-templated transcription
GO:0006259	0.861	DNA metabolic process
GO:2001020	0.852	regulation of response to DNA damage stimulus
GO:0018393	0.838	internal peptidyl-lysine acetylation
GO:0051276	0.830	chromosome organization
GO:0051054	0.818	positive regulation of DNA metabolic process
GO:0006282	0.811	regulation of DNA repair
GO:2001022	0.810	positive regulation of response to DNA damage stimulus
GO:0051726	0.809	regulation of cell cycle
GO:0051246	0.807	regulation of protein metabolic process
GO:0045739	0.779	positive regulation of DNA repair
GO:0031399	0.751	regulation of protein modification process
GO:0031324	0.726	negative regulation of cellular metabolic process
GO:0045934	0.716	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.701	negative regulation of macromolecule metabolic process
GO:2000278	0.670	regulation of DNA biosynthetic process
GO:0051053	0.650	negative regulation of DNA metabolic process
GO:0032200	0.601	telomere organization
GO:0032206	0.598	positive regulation of telomere maintenance
GO:0016573	0.579	histone acetylation
GO:0065009	0.540	regulation of molecular function
GO:0006338	0.532	chromatin remodeling
GO:0010557	0.503	positive regulation of macromolecule biosynthetic process
GO:0031328	0.503	positive regulation of cellular biosynthetic process
GO:0010639	0.497	negative regulation of organelle organization
GO:0051254	0.479	positive regulation of RNA metabolic process
GO:2001251	0.446	negative regulation of chromosome organization
GO:0010558	0.404	negative regulation of macromolecule biosynthetic process
GO:0031327	0.401	negative regulation of cellular biosynthetic process
GO:0045893	0.400	positive regulation of DNA-templated transcription
GO:0043967	0.388	histone H4 acetylation
GO:0050790	0.372	regulation of catalytic activity
GO:0032879	0.351	regulation of localization
GO:0051239	0.336	regulation of multicellular organismal process
GO:0051247	0.323	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0031981	0.999	nuclear lumen
GO:0005737	0.998	cytoplasm
GO:0005654	0.987	nucleoplasm
GO:0012505	0.977	endomembrane system
GO:0005730	0.875	nucleolus
GO:1902494	0.860	catalytic complex
GO:0005694	0.800	chromosome
GO:0140513	0.773	nuclear protein-containing complex
GO:0120025	0.547	plasma membrane bounded cell projection
GO:0000785	0.522	chromatin
GO:1990904	0.503	ribonucleoprotein complex
GO:1990234	0.498	transferase complex
GO:0005783	0.424	endoplasmic reticulum
GO:0043005	0.410	neuron projection
GO:0036477	0.398	somatodendritic compartment
GO:0030425	0.379	dendrite
GO:0005844	0.352	polysome
GO:0000123	0.323	histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]