StarFunc result for job id Q96F07

User Input

>input (1278 residues)
MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLAD
IVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMVQIRDDHIRFI
SELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIY
AALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKG
GFDIKVPRRAVGPSSTQACQWSPRALFHPTGGTQGRRGCRSLLYMVRTMLESLIADKSGS
KKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRI
QFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVN
LCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQ
LLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHM
TLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQ
RDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKI
VKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQS
LREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAP
LHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTN
GVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDL
FDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTV
EHVRCFQPPIHQSLATTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7usdA	0.900	0.970	0.000	1185	0.819	0.884	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
2	AFDB:A0A2R8PX02	0.953	0.971	0.000	1254	0.961	0.979	A0A2R8PX02.pdb.gz
3	AFDB:D4A8H8	0.956	0.975	0.000	1253	0.856	0.873	D4A8H8.pdb.gz	D4A8H8_RAT Cytoplasmic FMR1-interacting protein OS=Rattus norvegicus OX=10116 GN=Cyfip1 PE=3 SV=1
4	AFDB:O44518	0.929	0.941	0.000	1262	0.506	0.513	O44518.pdb.gz	CYFIP_CAEEL Cytoplasmic FMR1-interacting protein homolog OS=Caenorhabditis elegans OX=6239 GN=gex-2 PE=1 SV=4
5	AFDB:Q96F07	1.000	1.000	0.000	1278	1.000	1.000	Q96F07.pdb.gz	CYFP2_HUMAN Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2 PE=1 SV=2
6	AFDB:Q9VF87	0.949	0.940	0.000	1291	0.656	0.649	Q9VF87.pdb.gz	CYFIP_DROME Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Cyfip PE=1 SV=1
7	AFDB:Q6UK63	0.866	0.830	5.125E-78	1336	0.367	0.351	Q6UK63.pdb.gz	PIRA_DICDI Protein pirA OS=Dictyostelium discoideum OX=44689 GN=pirA PE=1 SV=1
8	AFDB:Q5S2C3	0.827	0.824	7.295E-61	1282	0.274	0.273	Q5S2C3.pdb.gz	PIR_ARATH Protein PIR OS=Arabidopsis thaliana OX=3702 GN=PIR PE=1 SV=2
9	AFDB:E7F4L4	0.489	0.524	5.203E-17	1173	0.120	0.130	E7F4L4.pdb.gz	E7F4L4_DANRE WASH complex subunit 4 OS=Danio rerio OX=7955 GN=si:dkey-23p11.2 PE=1 SV=1
10	AFDB:Q54R74	0.441	0.479	3.690E-16	1135	0.122	0.137	Q54R74.pdb.gz	WASC4_DICDI WASH complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=washc4 PE=1 SV=1
11	AFDB:A0A087X256	0.462	0.494	3.312E-15	1174	0.121	0.132	A0A087X256.pdb.gz	A0A087X256_HUMAN WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=1
12	PDB:7useB	0.409	0.464	2.947E-13	1099	0.124	0.144	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
13	PDB:7jq9A	0.080	0.054	3.202E-4	2427	0.124	0.066	7jq9A.pdb.gz
14	PDB:6n1zA	0.073	0.092	7.292E-4	961	0.095	0.127	6n1zA.pdb.gz
15	PDB:7ajlAAA	0.169	0.636	1.476E-3	290	0.039	0.172	7ajlAAA.pdb.gz
16	PDB:7tzcA	0.107	0.052	1.476E-3	4404	0.110	0.032	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
17	PDB:7wttK	0.075	0.087	1.796E-3	1022	0.119	0.149	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:7mp5A	0.064	0.054	2.362E-3	1629	0.103	0.081	7mp5A.pdb.gz
19	PDB:7mvxA	0.084	0.073	3.932E-3	1645	0.116	0.090	7mvxA.pdb.gz
20	PDB:7mopA	0.085	0.059	4.599E-3	2445	0.118	0.062	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K472	0.0	2246	1251	0.839	0.857	A0A0G2K472_RAT Cytoplasmic FMR1-interacting protein OS=Rattus norvegicus OX=10116 GN=Cyfip1 PE=1 SV=1
2	A5A5E1	0.0	2555	1253	0.962	0.982	A5A5E1_DANRE Cytoplasmic FMR1-interacting protein OS=Danio rerio OX=7955 GN=zgc:194528 PE=1 SV=1
3	B3DIT1	0.0	2559	1252	0.962	0.982	B3DIT1_DANRE Cytoplasmic FMR1-interacting protein OS=Danio rerio OX=7955 GN=zgc:194528 PE=1 SV=1
4	D4A8H8	0.0	2313	1253	0.858	0.875	D4A8H8_RAT Cytoplasmic FMR1-interacting protein OS=Rattus norvegicus OX=10116 GN=Cyfip1 PE=3 SV=1
5	O44518	0.0	1324	1262	0.510	0.517	CYFIP_CAEEL Cytoplasmic FMR1-interacting protein homolog OS=Caenorhabditis elegans OX=6239 GN=gex-2 PE=1 SV=4
6	Q5SQX6	0.0	2603	1253	0.980	0.999	CYFP2_MOUSE Cytoplasmic FMR1-interacting protein 2 OS=Mus musculus OX=10090 GN=Cyfip2 PE=1 SV=2
7	Q6UK63	0.0	791	1336	0.370	0.354	PIRA_DICDI Protein pirA OS=Dictyostelium discoideum OX=44689 GN=pirA PE=1 SV=1
8	Q7L576	0.0	2311	1253	0.859	0.876	CYFP1_HUMAN Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1
9	Q7TMB8	0.0	2311	1253	0.857	0.874	CYFP1_MOUSE Cytoplasmic FMR1-interacting protein 1 OS=Mus musculus OX=10090 GN=Cyfip1 PE=1 SV=1
10	Q96F07	0.0	2672	1278	1.000	1.000	CYFP2_HUMAN Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2 PE=1 SV=2
11	Q9VF87	0.0	1760	1291	0.661	0.655	CYFIP_DROME Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Cyfip PE=1 SV=1
12	Q5S2C3	1.36e-158	511	1282	0.297	0.296	PIR_ARATH Protein PIR OS=Arabidopsis thaliana OX=3702 GN=PIR PE=1 SV=2
13	Q09387	0.002	44.3	334	0.034	0.129	Q09387_CAEEL CYRIA/CYRIB Rac1 binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_R07G3.8 PE=1 SV=1
14	P85091	0.27	33.5	51	0.016	0.392	CYFP1_BOVIN Cytoplasmic FMR1-interacting protein 1 (Fragments) OS=Bos taurus OX=9913 GN=CYFIP1 PE=1 SV=1
15	Q04431	3.0	34.3	385	0.034	0.112	KRE28_YEAST Spindle pole body component KRE28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE28 PE=1 SV=1
16	Q9P3U2	4.0	34.3	741	0.012	0.020	YKX4_SCHPO Uncharacterized AAA domain-containing protein C328.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC328.04 PE=3 SV=1
17	Q24170	8.3	33.1	966	0.011	0.014	Q24170_DROME KSR OS=Drosophila melanogaster OX=7227 GN=ksr PE=2 SV=1
18	Q8I0R4	8.3	33.1	966	0.011	0.014	Q8I0R4_DROME Kinase suppressor of ras OS=Drosophila melanogaster OX=7227 GN=ksr PE=4 SV=1
19	Q8ISD8	8.3	33.1	966	0.011	0.014	Q8ISD8_DROME Kinase suppressor of ras OS=Drosophila melanogaster OX=7227 GN=ksr PE=4 SV=1
20	Q24171	8.4	33.1	966	0.011	0.014	Q24171_DROME AT08303p OS=Drosophila melanogaster OX=7227 GN=ksr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07159 CYRIA-B_Rac1-bd	7.4e-05	33.7	CYRIA/CYRIB Rac1 binding domain
2	PF05994 FragX_IP	0	1296.5	Cytoplasmic Fragile-X interacting family
3	PF07496 zf-CW	2.2e+02	13.2	CW-type Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006766360.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006758322.1	0.999	BRICK1, SCAR/WAVE actin nucleating complex subunit
2	225400.XP_006760609.1	0.999	Nck-associated protein 1
3	225400.XP_006777245.1	0.999	wiskott-Aldrich syndrome protein family member 1 isoform X1
4	225400.XP_006756993.1	0.994	Nck-associated protein 1-like
5	225400.XP_006770481.1	0.994	Abl interactor 1-like
6	225400.XP_006759459.1	0.991	Abl interactor 2 isoform X1
7	225400.XP_006753816.1	0.988	wiskott-Aldrich syndrome protein family member 3 isoform X1
8	225400.XP_006761711.1	0.984	Fragile X mental retardation syndrome-related protein 2
9	225400.XP_006773095.1	0.977	Eukaryotic translation initiation factor 4E
10	225400.XP_006757350.1	0.974	Fragile X mental retardation protein 1 homolog isoform X1
11	225400.XP_006777540.1	0.967	WAS protein family member 2
12	225400.XP_006763775.1	0.940	Eukaryotic translation initiation factor 4E type 1B
13	225400.XP_006770078.1	0.933	Fragile X mental retardation syndrome-related protein 1
14	225400.XP_006760490.1	0.916	Eukaryotic translation initiation factor 4E type 2 isoform X1
15	225400.XP_006768970.1	0.914	Actin-related protein 2/3 complex subunit 3
16	225400.XP_006753531.1	0.909	Cytoplasmic FMR1-interacting protein 1 isoform X1
17	225400.XP_006758312.1	0.909	Actin related protein 2/3 complex subunit 4
18	225400.XP_006757489.1	0.905	Ras-related C3 botulinum toxin substrate 2
19	225400.XP_006763385.1	0.901	Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks
20	225400.XP_006764427.1	0.884	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.689	heterocyclic compound binding
GO:0097159	0.676	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.956	cellular component organization
GO:0065007	0.944	biological regulation
GO:0048731	0.925	system development
GO:0007399	0.924	nervous system development
GO:0050789	0.918	regulation of biological process
GO:0030154	0.908	cell differentiation
GO:0032990	0.886	cell part morphogenesis
GO:0050896	0.876	response to stimulus
GO:0031175	0.869	neuron projection development
GO:0050794	0.851	regulation of cellular process
GO:0000902	0.844	cell morphogenesis
GO:0042221	0.818	response to chemical
GO:0048858	0.810	cell projection morphogenesis
GO:0031290	0.758	retinal ganglion cell axon guidance
GO:0048518	0.742	positive regulation of biological process
GO:0050905	0.699	neuromuscular process
GO:0010842	0.693	retina layer formation
GO:0001964	0.676	startle response
GO:0048522	0.658	positive regulation of cellular process
GO:0065008	0.541	regulation of biological quality
GO:0051128	0.537	regulation of cellular component organization
GO:0044087	0.526	regulation of cellular component biogenesis
GO:0051493	0.440	regulation of cytoskeleton organization
GO:0022607	0.418	cellular component assembly
GO:0032956	0.411	regulation of actin cytoskeleton organization
GO:0051716	0.410	cellular response to stimulus
GO:0044089	0.404	positive regulation of cellular component biogenesis
GO:0051130	0.367	positive regulation of cellular component organization
GO:0032535	0.348	regulation of cellular component size

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.997	cell junction
GO:0005737	0.997	cytoplasm
GO:0032991	0.996	protein-containing complex
GO:0045202	0.985	synapse
GO:0043226	0.971	organelle
GO:0031209	0.966	SCAR complex
GO:0043229	0.957	intracellular organelle
GO:0043227	0.935	membrane-bounded organelle
GO:0005886	0.927	plasma membrane
GO:0042995	0.880	cell projection
GO:0005829	0.877	cytosol
GO:0031982	0.870	vesicle
GO:0043231	0.857	intracellular membrane-bounded organelle
GO:0120025	0.843	plasma membrane bounded cell projection
GO:0005634	0.720	nucleus
GO:0070161	0.688	anchoring junction
GO:0043228	0.599	non-membrane-bounded organelle
GO:0043232	0.584	intracellular non-membrane-bounded organelle
GO:0031410	0.554	cytoplasmic vesicle
GO:0012505	0.536	endomembrane system
GO:0098794	0.491	postsynapse
GO:0031252	0.446	cell leading edge
GO:0043005	0.399	neuron projection
GO:0031981	0.350	nuclear lumen
GO:0005654	0.309	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]