StarFunc result for job id Q96F25

User Input

>input (216 residues)
MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLS
NAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVF
TTLHSMWLSFPLIHRVKPDLVLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVET
LSMSGKILFHLSDYFIVQWPALKEKYPKSVYLGRIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96F25	1.000	1.000	6.534E-43	216	1.000	1.000	Q96F25.pdb.gz	ALG14_HUMAN UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens OX=9606 GN=ALG14 PE=1 SV=1
2	AFDB:Q54G73	0.739	0.407	4.511E-18	398	0.389	0.211	Q54G73.pdb.gz	Q54G73_DICDI Glycosyl transferase family 28 C-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=ugt1 PE=3 SV=1
3	AFDB:O14199	0.755	0.776	8.958E-18	210	0.417	0.429	O14199.pdb.gz	ALG14_SCHPO UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg14 PE=3 SV=1
4	AFDB:P38242	0.819	0.752	4.282E-16	237	0.306	0.278	P38242.pdb.gz	ALG14_YEAST UDP-N-acetylglucosamine transferase subunit ALG14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG14 PE=1 SV=1
5	PDB:1f0kA	0.585	0.373	5.965E-5	351	0.144	0.088	1f0kA.pdb.gz
6	AFDB:P17443	0.575	0.362	6.189E-5	355	0.130	0.079	P17443.pdb.gz	MURG_ECOLI UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Escherichia coli (strain K12) OX=83333 GN=murG PE=1 SV=3
7	AFDB:Q5ZXH8	0.557	0.341	8.997E-5	377	0.148	0.085	Q5ZXH8.pdb.gz	NEUCH_LEGPH UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpg0753 PE=1 SV=1
8	AFDB:O35826	0.529	0.184	1.308E-4	722	0.102	0.030	O35826.pdb.gz	GLCNE_RAT Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Rattus norvegicus OX=10116 GN=Gne PE=1 SV=1
9	AFDB:Q0P8T0	0.503	0.306	1.577E-4	384	0.130	0.073	Q0P8T0.pdb.gz	NEUCH_CAMJE GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=legG PE=1 SV=1
10	AFDB:A0A0R4II12	0.509	0.173	2.943E-4	748	0.120	0.035	A0A0R4II12.pdb.gz
11	PDB:3d0rB	0.374	0.229	7.694E-4	381	0.144	0.081	3d0rB.pdb.gz
12	PDB:5zueA	0.447	0.337	9.875E-4	309	0.144	0.100	5zueA.pdb.gz	Lateral interactions between protofilaments of the bacterial tubulin homolog FtsZ are essential for cell division
13	AFDB:P74646	0.360	0.194	1.235E-3	519	0.144	0.060	P74646.pdb.gz	KAIC1_SYNY3 Circadian clock oscillator protein KaiC 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=kaiC1 PE=1 SV=1
14	PDB:1f6dA	0.548	0.333	2.222E-3	376	0.116	0.066	1f6dA.pdb.gz	The structure of UDP-N-acetylglucosamine 2-epimerase reveals homology to phosphoglycosyl transferases.
15	PDB:3ivcA	0.393	0.301	2.222E-3	298	0.106	0.077	3ivcA.pdb.gz	Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
16	PDB:6ijaD	0.497	0.308	2.851E-3	389	0.106	0.059	6ijaD.pdb.gz	Crystal structures of rhamnosyltransferase UGT89C1 from Arabidopsis thaliana reveal the molecular basis of sugar donor specificity for UDP-beta-l-rhamnose and rhamnosylation mechanism.
17	PDB:3vzxB	0.246	0.238	7.266E-3	228	0.074	0.070	3vzxB.pdb.gz	Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
18	PDB:1nasA	0.326	0.288	9.325E-3	259	0.120	0.100	1nasA.pdb.gz	The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
19	PDB:2q1xB	0.430	0.340	9.925E-3	287	0.093	0.070	2q1xB.pdb.gz
20	PDB:2y8uB	0.240	0.241	9.925E-3	212	0.097	0.099	2y8uB.pdb.gz	Structure and function of a broad-specificity chitin deacetylase from Aspergillus nidulans FGSC A4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96F25	1.66e-159	441	216	1.000	1.000	ALG14_HUMAN UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens OX=9606 GN=ALG14 PE=1 SV=1
2	Q54G73	2.67e-41	146	398	0.380	0.206	Q54G73_DICDI Glycosyl transferase family 28 C-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=ugt1 PE=3 SV=1
3	O14199	3.42e-40	138	210	0.384	0.395	ALG14_SCHPO UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg14 PE=3 SV=1
4	P38242	2.28e-23	95.5	237	0.319	0.291	ALG14_YEAST UDP-N-acetylglucosamine transferase subunit ALG14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG14 PE=1 SV=1
5	G5EEL5	0.69	33.1	365	0.097	0.058	DBL1_CAEEL Protein dbl-1 OS=Caenorhabditis elegans OX=6239 GN=dbl-1 PE=1 SV=1
6	F4IZV1	0.70	33.1	345	0.106	0.067	F4IZV1_ARATH Concanavalin A-like lectin family protein OS=Arabidopsis thaliana OX=3702 GN=At3g09190 PE=4 SV=1
7	Q8WXI7	2.1	32.0	14507	0.056	0.001	MUC16_HUMAN Mucin-16 OS=Homo sapiens OX=9606 GN=MUC16 PE=1 SV=3
8	I6Y242	2.2	31.2	243	0.069	0.062	I6Y242_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2956 PE=1 SV=1
9	P95136	2.2	31.2	243	0.069	0.062	P95136_MYCTX 2-O-methyltransferase NoeI OS=Mycobacterium tuberculosis OX=1773 GN=noeI_2 PE=4 SV=2
10	Q8H0T4	5.5	30.4	3658	0.079	0.005	UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3
11	Q99NH0	6.2	30.4	2603	0.130	0.011	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
12	Q8GY23	6.4	30.4	3681	0.079	0.005	UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
13	O75179	8.3	30.0	2603	0.130	0.011	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
14	H0YM23	8.6	30.0	2487	0.130	0.011	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
15	P56750	9.6	29.3	224	0.106	0.103	CLD17_HUMAN Claudin-17 OS=Homo sapiens OX=9606 GN=CLDN17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08660 Alg14	1.1e-62	222.6	Oligosaccharide biosynthesis protein Alg14 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378260	0.999	Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13
2	9606.ENSP00000386597	0.996	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
3	9606.ENSP00000262374	0.978	Chitobiosyldiphosphodolichol beta-mannosyltransferase
4	9606.ENSP00000430236	0.878	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
5	9606.ENSP00000309092	0.838	Mannose-1-phosphate guanyltransferase beta
6	9606.ENSP00000333813	0.826	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
7	9606.ENSP00000239891	0.798	ALG5, dolichyl-phosphate beta-glucosyltransferase
8	9606.ENSP00000360644	0.770	Dolichol-phosphate mannosyltransferase subunit 1
9	9606.ENSP00000380793	0.754	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
10	9606.ENSP00000360149	0.747	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
11	9606.ENSP00000417764	0.743	Alpha-1,3/1,6-mannosyltransferase ALG2
12	9606.ENSP00000349860	0.721	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
13	9606.ENSP00000386543	0.683	Prolyl endopeptidase-like
14	9606.ENSP00000482396	0.683	Alpha-1,2-mannosyltransferase ALG9
15	9606.ENSP00000482437	0.683	Mannosyltransferase
16	9606.ENSP00000266483	0.676	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
17	9606.ENSP00000310120	0.657	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
18	9606.ENSP00000353104	0.651	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
19	9606.ENSP00000344432	0.624	Protein Dok-7
20	9606.ENSP00000361667	0.615	Dolichol kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016758	1.000	hexosyltransferase activity
GO:0005515	0.999	protein binding
GO:0008194	0.413	UDP-glycosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0019538	0.990	protein metabolic process
GO:0044260	0.989	cellular macromolecule metabolic process
GO:0009059	0.985	macromolecule biosynthetic process
GO:0006486	0.978	protein glycosylation
GO:0044255	0.963	cellular lipid metabolic process
GO:0006487	0.897	protein N-linked glycosylation
GO:0006490	0.802	oligosaccharide-lipid intermediate biosynthetic process
GO:0006793	0.323	phosphorus metabolic process
GO:0006488	0.323	dolichol-linked oligosaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]