StarFunc result for job id Q96F44

User Input

>input (468 residues)
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLG
EFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIAELEGRCQLPA
LGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPEL
ILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCR
ENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96F44	1.000	1.000	4.936E-90	468	1.000	1.000	Q96F44.pdb.gz	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
2	AFDB:Q99PQ2	0.899	0.901	2.551E-79	467	0.895	0.897	Q99PQ2.pdb.gz	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
3	AFDB:Q5NCC9	0.702	0.679	4.246E-49	485	0.434	0.419	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
4	AFDB:P19474	0.706	0.696	2.355E-47	475	0.425	0.419	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
5	AFDB:A0A024RCR1	0.383	0.370	1.967E-46	488	0.436	0.418	A0A024RCR1.pdb.gz
6	AFDB:A0A024RCP5	0.534	0.492	2.083E-46	518	0.436	0.394	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
7	AFDB:A0A1U9X8R9	0.370	0.338	2.474E-46	513	0.417	0.380	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
8	AFDB:Q6AZZ1	0.539	0.521	2.189E-45	485	0.432	0.416	Q6AZZ1.pdb.gz	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
9	AFDB:Q9Y577	0.661	0.651	4.114E-45	477	0.453	0.444	Q9Y577.pdb.gz	TRI17_HUMAN E3 ubiquitin-protein ligase TRIM17 OS=Homo sapiens OX=9606 GN=TRIM17 PE=1 SV=1
10	AFDB:Q62191	0.681	0.679	4.887E-45	470	0.385	0.383	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
11	PDB:7y4sA	0.341	0.458	1.098E-20	343	0.169	0.230	7y4sA.pdb.gz
12	PDB:4b3nA	0.315	0.267	3.324E-15	557	0.126	0.106	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:4tn3B	0.335	0.420	1.492E-8	362	0.141	0.182	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7ccbA	0.273	0.706	6.262E-8	164	0.062	0.177	7ccbA.pdb.gz
15	PDB:7z36B	0.222	0.229	2.628E-7	446	0.122	0.128	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
16	PDB:7nscA	0.278	0.449	2.739E-5	276	0.047	0.080	7nscA.pdb.gz
17	PDB:7nsba	0.213	0.180	5.775E-5	568	0.075	0.062	7nsba.pdb.gz
18	PDB:6swy1	0.254	0.223	6.477E-5	542	0.081	0.070	6swy1.pdb.gz
19	PDB:7ua3A	0.193	0.027	1.085E-4	4443	0.066	0.007	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:7u9tA	0.187	0.028	1.531E-4	4229	0.062	0.007	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96F44	0.0	948	468	1.000	1.000	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
2	Q99PQ2	0.0	822	467	0.895	0.897	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
3	R4GMV1	0.0	665	343	0.709	0.968	R4GMV1_HUMAN Tripartite motif containing 11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=1
4	Q6AZZ1	1.48e-122	368	485	0.442	0.427	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
5	Q5NCC9	3.90e-120	362	485	0.440	0.425	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
6	A0A024RCP5	2.45e-119	360	518	0.440	0.398	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
7	Q9HCM9	2.45e-119	360	518	0.440	0.398	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
8	Q9Y577	7.03e-118	355	477	0.457	0.449	TRI17_HUMAN E3 ubiquitin-protein ligase TRIM17 OS=Homo sapiens OX=9606 GN=TRIM17 PE=1 SV=1
9	A0A1U9X8R9	8.29e-118	357	513	0.419	0.382	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
10	P14373	8.29e-118	357	513	0.419	0.382	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
11	Q62158	2.34e-117	355	513	0.421	0.384	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
12	P19474	1.40e-116	352	475	0.438	0.432	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
13	O00635	2.83e-104	320	465	0.404	0.406	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
14	Q3U7K7	1.88e-101	313	462	0.372	0.377	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
15	Q62191	2.54e-101	313	470	0.372	0.370	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
16	Q8BVP1	1.06e-96	301	470	0.380	0.379	TRIML_MOUSE Probable E3 ubiquitin-protein ligase TRIML1 OS=Mus musculus OX=10090 GN=Triml1 PE=1 SV=1
17	A0A096LP39	7.38e-92	289	503	0.335	0.312	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
18	Q9C030	4.14e-91	287	488	0.376	0.361	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
19	Q495X7	2.55e-90	284	471	0.346	0.344	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
20	Q8BGE7	1.35e-89	283	488	0.374	0.359	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11304 DUF3106	2.6e+02	13.5	Protein of unknown function (DUF3106)
2	PF14447 Prok-RING_4	4.5e+02	12.1	Prokaryotic RING finger family 4
3	PF13765 PRY	3.5e-20	82.7	SPRY-associated domain
4	PF00622 SPRY	5.5e-10	50.8	SPRY domain
5	PF04564 U-box	1.9e+02	13.7	U-box domain
6	PF00643 zf-B_box	0.0015	30.0	B-box zinc finger
7	PF00097 zf-C3HC4	5.8e-08	43.8	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	4.3e-05	34.5	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	0.0037	28.4	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	3.9e-09	47.8	zinc finger of C3HC4-type, RING
11	PF11789 zf-Nse	89	14.4	Zinc-finger of the MIZ type in Nse subunit
12	PF17123 zf-RING_11	7.1e+02	11.4	RING-like zinc finger
13	PF13639 zf-RING_2	0.0012	30.5	Ring finger domain
14	PF14634 zf-RING_5	0.14	23.4	zinc-RING finger domain
15	PF14835 zf-RING_6	1.3	20.3	zf-RING of BARD1-type protein
16	PF13445 zf-RING_UBOX	3.3e-06	38.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263205	0.832	Mediator of RNA polymerase II transcription subunit 15
2	9606.ENSP00000316176	0.820	Ubiquitin-conjugating enzyme E2 N
3	9606.ENSP00000362560	0.755	V-set and transmembrane domain-containing protein 2-like protein
4	9606.ENSP00000295756	0.681	T-cell receptor-associated transmembrane adapter 1
5	9606.ENSP00000253024	0.648	Transcription intermediary factor 1-beta
6	9606.ENSP00000384949	0.647	Pyrroline-5-carboxylate reductase 1, mitochondrial
7	9606.ENSP00000355388	0.636	M-phase phosphoprotein 8
8	9606.ENSP00000468897	0.630	N-formyl peptide receptor 2
9	9606.ENSP00000357112	0.628	Interferon-inducible protein AIM2
10	9606.ENSP00000263182	0.625	Gamma-butyrobetaine dioxygenase
11	9606.ENSP00000404100	0.596	Paired box protein Pax-6
12	9606.ENSP00000226382	0.573	Paired mesoderm homeobox protein 2B
13	9606.ENSP00000354632	0.537	ATP synthase subunit a
14	9606.ENSP00000262294	0.532	E3 ubiquitin-protein ligase TRIM37
15	9606.ENSP00000343129	0.528	Tripartite motif-containing protein 29
16	9606.ENSP00000268058	0.515	Protein PML
17	9606.ENSP00000299413	0.507	Tripartite motif-containing protein 44

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.988	catalytic activity
GO:0019787	0.971	ubiquitin-like protein transferase activity
GO:0004842	0.962	ubiquitin-protein transferase activity
GO:0061630	0.564	ubiquitin protein ligase activity
GO:0042802	0.348	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0048519	0.993	negative regulation of biological process
GO:0050896	0.989	response to stimulus
GO:0048518	0.983	positive regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0048525	0.963	negative regulation of viral process
GO:1903900	0.962	regulation of viral life cycle
GO:0009615	0.951	response to virus
GO:0043903	0.933	regulation of biological process involved in symbiotic interaction
GO:0051607	0.925	defense response to virus
GO:0052372	0.905	modulation by symbiont of entry into host
GO:0006955	0.877	immune response
GO:0046596	0.834	regulation of viral entry into host cell
GO:0019222	0.819	regulation of metabolic process
GO:0009987	0.814	cellular process
GO:0060255	0.800	regulation of macromolecule metabolic process
GO:0071704	0.772	organic substance metabolic process
GO:0045087	0.723	innate immune response
GO:0031323	0.646	regulation of cellular metabolic process
GO:0051171	0.643	regulation of nitrogen compound metabolic process
GO:0080090	0.636	regulation of primary metabolic process
GO:0044238	0.628	primary metabolic process
GO:0048522	0.622	positive regulation of cellular process
GO:0006807	0.617	nitrogen compound metabolic process
GO:0010468	0.587	regulation of gene expression
GO:0048524	0.556	positive regulation of viral process
GO:0009889	0.520	regulation of biosynthetic process
GO:1903901	0.514	negative regulation of viral life cycle
GO:0048583	0.508	regulation of response to stimulus
GO:0043170	0.505	macromolecule metabolic process
GO:1901564	0.488	organonitrogen compound metabolic process
GO:0031326	0.448	regulation of cellular biosynthetic process
GO:0048523	0.437	negative regulation of cellular process
GO:0051252	0.432	regulation of RNA metabolic process
GO:0010556	0.430	regulation of macromolecule biosynthetic process
GO:2001141	0.419	regulation of RNA biosynthetic process
GO:0019538	0.413	protein metabolic process
GO:1903506	0.408	regulation of nucleic acid-templated transcription
GO:0006355	0.387	regulation of DNA-templated transcription
GO:0009892	0.385	negative regulation of metabolic process
GO:0036211	0.340	protein modification process
GO:0009893	0.336	positive regulation of metabolic process
GO:0010605	0.335	negative regulation of macromolecule metabolic process
GO:0051172	0.318	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.971	Transferases.

[back to server]