StarFunc result for job id Q96F46

User Input

>input (866 residues)
MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDD
SWIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLN
TNERLCVRFEFLSKLRHHHRRWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNF
LVPDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFPHM
ENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSAT
VSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGPGSEKYSDDTK
YTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI
SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFT
AAMNMILPDFKRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLE
MFQPGRMHRVGELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPS
LDEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKLEPHLQPRGQP
APQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEGEACPLLGSPGAGRNSVLFLP
VDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSRPAMVLTDPHT
PYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ
RQLLFRQLQKNSGWDTMGSESEGPSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A740	0.606	0.605	0.000	868	0.684	0.682	D4A740.pdb.gz	D4A740_RAT Interleukin 17 receptor A OS=Rattus norvegicus OX=10116 GN=Il17ra PE=4 SV=2
2	AFDB:Q60943	0.574	0.576	0.000	864	0.682	0.684	Q60943.pdb.gz	I17RA_MOUSE Interleukin-17 receptor A OS=Mus musculus OX=10090 GN=Il17ra PE=1 SV=1
3	AFDB:Q96F46	1.000	1.000	0.000	866	1.000	1.000	Q96F46.pdb.gz	I17RA_HUMAN Interleukin-17 receptor A OS=Homo sapiens OX=9606 GN=IL17RA PE=1 SV=2
4	AFDB:Q2Q0I9	0.098	0.055	4.965E-8	1779	0.127	0.062	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
5	AFDB:F1RE66	0.113	0.092	9.676E-8	1134	0.110	0.084	F1RE66.pdb.gz	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
6	AFDB:Q9W213	0.131	0.089	1.596E-7	1395	0.118	0.073	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
7	AFDB:Q96MS0	0.114	0.079	2.783E-7	1386	0.113	0.071	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
8	AFDB:O55005	0.111	0.068	8.006E-7	1651	0.100	0.053	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
9	AFDB:Q9P2J2	0.080	0.060	1.321E-6	1179	0.141	0.103	Q9P2J2.pdb.gz	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2
10	AFDB:R9QT79	0.095	0.075	2.721E-6	1132	0.088	0.067	R9QT79.pdb.gz	R9QT79_ONCMY Long-form leptin receptor OS=Oncorhynchus mykiss OX=8022 GN=LepR PE=2 SV=1
11	PDB:2r51A	0.098	0.220	7.403E-6	288	0.029	0.087	2r51A.pdb.gz
12	PDB:1f13A	0.150	0.173	2.812E-5	722	0.032	0.039	1f13A.pdb.gz
13	PDB:7tvzE	0.153	0.191	3.513E-5	665	0.037	0.048	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
14	PDB:5f0jB	0.100	0.208	6.476E-5	306	0.029	0.082	5f0jB.pdb.gz
15	PDB:6kzbC	0.159	0.199	1.010E-4	649	0.030	0.040	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
16	PDB:4pygA	0.149	0.178	1.262E-4	685	0.032	0.041	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
17	PDB:5mhlA	0.135	0.161	2.201E-4	692	0.031	0.039	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
18	PDB:1l9mB	0.155	0.187	2.906E-4	681	0.032	0.041	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
19	PDB:7u7nC	0.105	0.303	7.908E-4	200	0.031	0.135	7u7nC.pdb.gz
20	PDB:8eyyA	0.116	0.127	9.343E-4	775	0.032	0.036	8eyyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A740	0.0	1126	868	0.684	0.682	D4A740_RAT Interleukin 17 receptor A OS=Rattus norvegicus OX=10116 GN=Il17ra PE=4 SV=2
2	Q60943	0.0	1120	864	0.681	0.683	I17RA_MOUSE Interleukin-17 receptor A OS=Mus musculus OX=10090 GN=Il17ra PE=1 SV=1
3	Q96F46	0.0	1774	866	1.000	1.000	I17RA_HUMAN Interleukin-17 receptor A OS=Homo sapiens OX=9606 GN=IL17RA PE=1 SV=2
4	Q9NRM6	6.24e-36	145	502	0.142	0.245	I17RB_HUMAN Interleukin-17 receptor B OS=Homo sapiens OX=9606 GN=IL17RB PE=1 SV=2
5	Q9JIP3	2.53e-31	131	499	0.135	0.234	I17RB_MOUSE Interleukin-17 receptor B OS=Mus musculus OX=10090 GN=Il17rb PE=1 SV=1
6	Q8NFM7	2.21e-20	99.0	739	0.089	0.104	I17RD_HUMAN Interleukin-17 receptor D OS=Homo sapiens OX=9606 GN=IL17RD PE=1 SV=3
7	C9IZN0	5.24e-19	91.7	348	0.107	0.267	C9IZN0_HUMAN Interleukin 17 receptor B (Fragment) OS=Homo sapiens OX=9606 GN=IL17RB PE=1 SV=1
8	Q8JZL1	1.61e-17	89.7	738	0.083	0.098	I17RD_MOUSE Interleukin-17 receptor D OS=Mus musculus OX=10090 GN=Il17rd PE=1 SV=1
9	Q8QHJ9	8.34e-16	84.3	745	0.070	0.082	I17RD_DANRE Interleukin-17 receptor D OS=Danio rerio OX=7955 GN=il17rd PE=1 SV=2
10	Q8NAC3	8.75e-06	52.0	791	0.057	0.062	I17RC_HUMAN Interleukin-17 receptor C OS=Homo sapiens OX=9606 GN=IL17RC PE=1 SV=2
11	Q8K4C2	6.44e-05	49.3	698	0.047	0.059	I17RC_MOUSE Interleukin-17 receptor C OS=Mus musculus OX=10090 GN=Il17rc PE=1 SV=3
12	Q10128	0.26	37.4	718	0.035	0.042	ILCR2_CAEEL Interleukin cytokine receptor-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=ilcr-2 PE=1 SV=1
13	Q13263	0.28	37.4	835	0.042	0.043	TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5
14	M0R0K9	0.47	36.6	460	0.042	0.078	M0R0K9_HUMAN Tripartite motif containing 28 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=1
15	Q9VH95	1.2	34.3	184	0.029	0.136	YC17_DROME Uncharacterized protein CG16817 OS=Drosophila melanogaster OX=7227 GN=CG16817 PE=1 SV=1
16	Q8BH06	1.5	35.0	637	0.039	0.053	I17RE_MOUSE Interleukin-17 receptor E OS=Mus musculus OX=10090 GN=Il17re PE=1 SV=1
17	Q9USS8	2.2	34.3	437	0.025	0.050	YNB2_SCHPO Uncharacterized protein C4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4.02c PE=1 SV=2
18	P28650	3.2	33.9	457	0.027	0.050	PURA1_MOUSE Adenylosuccinate synthetase isozyme 1 OS=Mus musculus OX=10090 GN=Adss1 PE=1 SV=2
19	M0R629	3.3	33.5	457	0.027	0.050	M0R629_RAT Adenylosuccinate synthetase isozyme 1 OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
20	Q7DMA9	4.0	33.5	635	0.037	0.050	PAS1_ARATH Peptidyl-prolyl cis-trans isomerase PASTICCINO1 OS=Arabidopsis thaliana OX=3702 GN=PAS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16556 IL17R_fnIII_D1	1.3e-66	234.4	Interleukin-17 receptor, fibronectin-III-like domain 1
2	PF16578 IL17R_fnIII_D2	4.8e-51	183.0	Interleukin 17 receptor D
3	PF08357 SEFIR	1.7e-38	143.7	SEFIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320936

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337432	0.999	Interleukin-17F
2	9606.ENSP00000344192	0.999	Interleukin-17A
3	9606.ENSP00000373325	0.998	Interleukin-17 receptor E
4	9606.ENSP00000328111	0.995	Interleukin-25
5	9606.ENSP00000433623	0.994	TNF receptor-associated factor 6
6	9606.ENSP00000357750	0.986	Adapter protein CIKS
7	9606.ENSP00000454207	0.984	TNF receptor-associated factor 3
8	9606.ENSP00000244241	0.979	Interleukin-17C
9	9606.ENSP00000295981	0.895	Interleukin-17 receptor C
10	9606.ENSP00000288167	0.865	Interleukin-17 receptor B
11	9606.ENSP00000261796	0.814	Interleukin-17B
12	9606.ENSP00000302924	0.772	Interleukin-17D
13	9606.ENSP00000011653	0.736	T-cell surface glycoprotein CD4
14	9606.ENSP00000261464	0.707	TNF receptor-associated factor 5
15	9606.ENSP00000385675	0.674	Interleukin-6
16	9606.ENSP00000228534	0.669	Interleukin-23 subunit alpha
17	9606.ENSP00000442424	0.662	Interleukin-22
18	9606.ENSP00000379110	0.660	Growth-regulated alpha protein
19	9606.ENSP00000386380	0.657	Interleukin-1 receptor type 1
20	9606.ENSP00000398698	0.648	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030368	1.000	interleukin-17 receptor activity
GO:0005102	0.638	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0051239	0.995	regulation of multicellular organismal process
GO:0019221	0.992	cytokine-mediated signaling pathway
GO:0001817	0.989	regulation of cytokine production
GO:0048518	0.987	positive regulation of biological process
GO:0048583	0.980	regulation of response to stimulus
GO:0009893	0.965	positive regulation of metabolic process
GO:0001819	0.956	positive regulation of cytokine production
GO:0048584	0.952	positive regulation of response to stimulus
GO:0032101	0.942	regulation of response to external stimulus
GO:0080134	0.939	regulation of response to stress
GO:0031347	0.930	regulation of defense response
GO:0051707	0.905	response to other organism
GO:1900015	0.900	regulation of cytokine production involved in inflammatory response
GO:0032103	0.859	positive regulation of response to external stimulus
GO:0031349	0.774	positive regulation of defense response
GO:0050727	0.757	regulation of inflammatory response
GO:0032501	0.709	multicellular organismal process
GO:0002376	0.638	immune system process
GO:0048522	0.591	positive regulation of cellular process
GO:0006950	0.441	response to stress
GO:0001775	0.432	cell activation
GO:0050729	0.428	positive regulation of inflammatory response
GO:0006952	0.402	defense response
GO:0009615	0.371	response to virus
GO:0032755	0.339	positive regulation of interleukin-6 production
GO:0006955	0.335	immune response
GO:0032642	0.335	regulation of chemokine production
GO:0032722	0.322	positive regulation of chemokine production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.588	intracellular anatomical structure
GO:0005737	0.372	cytoplasm
GO:0043226	0.337	organelle
GO:0043227	0.333	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]