StarFunc result for job id Q96F81

User Input

>input (1524 residues)
MAMSNGNNDFVVLSNSSIATSAANPSPLTPCDGDHAAQQLTPKEATRTKVSPNGCLQLNG
TVKSSFLPLDNQRMPQMLPQCCHPCPYHHPLTSHSSHQECHPEAGPAAPSALASCCMQPH
SEYSASLCPNHSPVYQTTCCLQPSPSFCLHHPWPDHFQHQPVQQHIANIRPSRPFKLPKS
YAALIADWPVVVLGMCTMFIVVCALVGVLVPELPDFSDPLLGFEPRGTAIGQRLVTWNNM
VKNTGYKATLANYPFKYADEQAKSHRDDRWSDDHYEREKREVDWNFHKDSFFCDVPSDRY
SRVVFTSSGGETLWNLPAIKSMCNVDNSRIRSHPQFGDLCQRTTAASCCPSWTLGNYIAI
LNNRSSCQKIVERDVSHTLKLLRTCAKHYQNGTLGPDCWDMAARRKDQLKCTNVPRKCTK
YNAVYQILHYLVDKDFMTPKTADYATPALKYSMLFSPTEKGESMMNIYLDNFENWNSSDG
VTTITGIEFGIKHSLFQDYLLMDTVYPAIAIVIVLLVMCVYTKSMFITLMTMFAIISSLI
VSYFLYRVVFHFEFFPFMNLTALIILVGIGADDAFVLCDVWNYTKFDKPHAETSETVSIT
LQHAALSMFVTSFTTAAAFYANYVSNITAIRCFGVYAGTAILVNYVLMVTWLPAVVVLHE
RYLLNIFTCFKKPQQQIYDNKSCWTVACQKCHKVLFAISEASRIFFEKVLPCIVIKFRYL
WLFWFLALTVGGAYIVCINPKMKLPSLELSEFQVFRSSHPFERYDAEYKKLFMFERVHHG
EELHMPITVIWGVSPEDNGNPLNPKSKGKLTLDSSFNIASPASQAWILHFCQKLRNQTFF
YQTDEQDFTSCFIETFKQWMENQDCDEPALYPCCSHWSFPYKQEIFELCIKRAIMELERS
TGYHLDSKTPGPRFDINDTIRAVVLEFQSTYLFTLAYEKMHQFYKEVDSWISSELSSAPE
GLSNGWFVSNLEFYDLQDSLSDGTLIAMGLSVAVAFSVMLLTTWNIIISLYAIISIAGTI
FVTVGSLVLLGWELNVLESVTISVAVGLSVDFAVHYGVAYRLAPDPDREGKVIFSLSRVG
SAMAMAALTTFVAGAMMMPSTVLAYTQLGTFMMLIMCISWAFATFFFQCMCRCLGPQGTC
GQIPLPKKLQCSAFSHALSTSPSDKGQSKTHTINAYHLDPRGPKSELEHEFYELEPLASH
SCTAPEKTTYEETHICSEFFNSQAKNLGMPVHAAYNSELSKSTESDAGSALLQPPLEQHT
VCHFFSLNQRCSCPDAYKHLNYGPHSCQQMGDCLCHQCSPTTSSFVQIQNGVAPLKATHQ
AVEGFVHPITHIHHCPCLQGRVKPAGMQNSLPRNFFLHPVQHIQAQEKIGKTNVHSLQRS
IEEHLPKMAEPSSFVCRSTGSLLKTCCDPENKQRELCKNRDVSNLESSGGTENKAGGKVE
LSLSQTDASVNSEHFNQNEPKVLFNHLMGEAGCRSCPNNSQSCGRIVRVKCNSVDCQMPN
MEANVPAVLTHSELSGESLLIKTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TDN0	0.672	0.673	0.000	1521	0.841	0.842	Q3TDN0.pdb.gz	DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus OX=10090 GN=Disp1 PE=1 SV=2
2	AFDB:Q6R5J2	0.654	0.680	0.000	1464	0.615	0.641	Q6R5J2.pdb.gz	DISP1_DANRE Protein dispatched homolog 1 OS=Danio rerio OX=7955 GN=disp1 PE=2 SV=1
3	AFDB:Q96F81	1.000	1.000	0.000	1524	1.000	1.000	Q96F81.pdb.gz	DISP1_HUMAN Protein dispatched homolog 1 OS=Homo sapiens OX=9606 GN=DISP1 PE=1 SV=3
4	PDB:7e2iD	0.570	0.944	1.696E-97	907	0.591	0.993	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.
5	AFDB:Q6R5J1	0.617	0.636	5.836E-93	1476	0.325	0.335	Q6R5J1.pdb.gz	DISP2_DANRE Protein dispatched homolog 2 OS=Danio rerio OX=7955 GN=disp2 PE=2 SV=1
6	PDB:6tbuA	0.520	0.929	1.515E-61	842	0.216	0.391	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
7	PDB:6v3fA	0.367	0.441	2.253E-19	1234	0.099	0.122	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
8	PDB:7n6bA	0.351	0.653	1.583E-16	757	0.069	0.139	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
9	PDB:6dmyA	0.366	0.533	3.158E-14	992	0.085	0.131	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
10	PDB:7wnxA	0.324	0.623	3.923E-14	734	0.079	0.165	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
11	PDB:3nogA	0.253	0.360	8.537E-12	1012	0.085	0.128	3nogA.pdb.gz
12	PDB:2v50D	0.218	0.321	3.424E-11	998	0.057	0.087	2v50D.pdb.gz
13	PDB:3w9iF	0.268	0.380	7.812E-11	1033	0.081	0.120	3w9iF.pdb.gz
14	PDB:4zivB	0.276	0.379	8.898E-11	1046	0.088	0.128	4zivB.pdb.gz
15	AFDB:Q9Z0Y8	0.059	0.048	2.447E-2	2201	0.123	0.085	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
16	AFDB:Q54DW1	0.053	0.050	3.040E-2	1736	0.117	0.103	Q54DW1.pdb.gz	Q54DW1_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=docC PE=3 SV=1
17	AFDB:F4HS99	0.045	0.041	3.944E-2	1797	0.061	0.052	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
18	AFDB:F4HZK4	0.043	0.041	1.070E-1	1608	0.067	0.063	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
19	AFDB:P29539	0.053	0.046	1.450E-1	1916	0.142	0.113	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
20	AFDB:F4JKH6	0.047	0.043	1.582E-1	1819	0.077	0.064	F4JKH6.pdb.gz	REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2 OS=Arabidopsis thaliana OX=3702 GN=REC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7MBM2	0.0	822	1401	0.291	0.316	DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapiens OX=9606 GN=DISP2 PE=2 SV=2
2	Q3TDN0	0.0	2666	1521	0.842	0.844	DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus OX=10090 GN=Disp1 PE=1 SV=2
3	Q6R5J1	0.0	860	1476	0.295	0.305	DISP2_DANRE Protein dispatched homolog 2 OS=Danio rerio OX=7955 GN=disp2 PE=2 SV=1
4	Q6R5J2	0.0	1842	1464	0.594	0.618	DISP1_DANRE Protein dispatched homolog 1 OS=Danio rerio OX=7955 GN=disp1 PE=2 SV=1
5	Q8CIP5	0.0	818	1345	0.285	0.323	DISP2_MOUSE Protein dispatched homolog 2 OS=Mus musculus OX=10090 GN=Disp2 PE=1 SV=1
6	Q96F81	0.0	3197	1524	1.000	1.000	DISP1_HUMAN Protein dispatched homolog 1 OS=Homo sapiens OX=9606 GN=DISP1 PE=1 SV=3
7	Q9VNJ5	1.76e-176	563	1218	0.213	0.267	DISP_DROME Protein dispatched OS=Drosophila melanogaster OX=7227 GN=disp PE=1 SV=1
8	G5EEW0	5.20e-55	211	917	0.150	0.250	G5EEW0_CAEEL CHE-14 protein OS=Caenorhabditis elegans OX=6239 GN=che-14 PE=1 SV=1
9	B9U3F2	7.83e-16	86.3	1338	0.043	0.049	DISP3_CHICK Protein dispatched homolog 3 OS=Gallus gallus OX=9031 GN=DISP3 PE=1 SV=1
10	Q9P2K9	1.77e-15	85.1	1392	0.035	0.039	DISP3_HUMAN Protein dispatched homolog 3 OS=Homo sapiens OX=9606 GN=DISP3 PE=2 SV=2
11	Q86P36	2.80e-09	64.7	1169	0.081	0.105	Q86P36_DROME Patched-related, isoform A OS=Drosophila melanogaster OX=7227 GN=Ptr PE=2 SV=1
12	M0R3Q7	3.42e-09	64.3	905	0.033	0.056	PTHD3_RAT Patched domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Ptchd3 PE=1 SV=1
13	Q0EEE2	3.91e-09	63.9	906	0.036	0.061	PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus OX=10090 GN=Ptchd3 PE=1 SV=1
14	H1UBK7	1.92e-07	58.5	888	0.020	0.035	H1UBK7_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ptr-22 PE=4 SV=1
15	H1UBK6	2.73e-07	57.8	680	0.020	0.046	H1UBK6_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ptr-22 PE=4 SV=1
16	G3V7K5	8.44e-07	56.6	1278	0.023	0.027	G3V7K5_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=3 SV=1
17	Q9U5W1	8.45e-07	56.6	1287	0.031	0.037	Q9U5W1_DROME NPC1 protein OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
18	A0A8I6GB30	8.64e-07	56.6	1265	0.023	0.028	A0A8I6GB30_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
19	A0A8I6AL97	8.93e-07	56.2	1259	0.023	0.028	A0A8I6AL97_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
20	F1QNG7	1.04e-06	56.2	1276	0.036	0.043	F1QNG7_DANRE Niemann-Pick C1 protein isoform X2 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03176 MMPL	4.8e-10	50.5	MMPL family
2	PF02460 Patched	2.7e-18	77.2	Patched family
3	PF12349 Sterol-sensing	3.9e-08	44.8	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297261	0.995	Sonic hedgehog protein
2	9606.ENSP00000266991	0.906	Desert hedgehog protein
3	9606.ENSP00000295731	0.901	Indian hedgehog protein
4	9606.ENSP00000365514	0.771	Zinc finger protein ZIC 2
5	9606.ENSP00000260653	0.768	Homeobox protein SIX3
6	9606.ENSP00000400341	0.740	Hepatocyte nuclear factor 3-beta
7	9606.ENSP00000438468	0.730	Protein-cysteine N-palmitoyltransferase HHAT
8	9606.ENSP00000361769	0.642	Regulating synaptic membrane exocytosis protein 3
9	9606.ENSP00000358918	0.615	Suppressor of fused homolog
10	9606.ENSP00000249373	0.609	Smoothened homolog
11	9606.ENSP00000446828	0.609	3'(2'),5'-bisphosphate nucleotidase 1
12	9606.ENSP00000390436	0.587	Zinc finger protein GLI2
13	9606.ENSP00000361266	0.580	Protein patched homolog 2
14	9606.ENSP00000302640	0.579	Nucleolar transcription factor 1
15	9606.ENSP00000429969	0.579	Signal peptide, CUB domain and EGF like domain containing 2
16	9606.ENSP00000356370	0.564	Protein crumbs homolog 1
17	9606.ENSP00000376458	0.557	Cell adhesion molecule-related/down-regulated by oncogenes
18	9606.ENSP00000257312	0.551	Zinc finger protein DZIP1
19	9606.ENSP00000339883	0.548	Lamin-B receptor
20	9606.ENSP00000272134	0.539	Left-right determination factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.346	organic cyclic compound binding
GO:0005215	0.320	transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0048856	0.986	anatomical structure development
GO:0007275	0.966	multicellular organism development
GO:0048513	0.878	animal organ development
GO:0048731	0.869	system development
GO:0065007	0.861	biological regulation
GO:0009987	0.790	cellular process
GO:0050789	0.765	regulation of biological process
GO:0050794	0.744	regulation of cellular process
GO:0007517	0.529	muscle organ development
GO:0050896	0.475	response to stimulus
GO:0051716	0.320	cellular response to stimulus
GO:0023052	0.319	signaling
GO:0007154	0.319	cell communication
GO:0007165	0.311	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005737	0.983	cytoplasm
GO:0012505	0.748	endomembrane system
GO:0120025	0.737	plasma membrane bounded cell projection
GO:0005634	0.402	nucleus
GO:0035230	0.370	cytoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]