StarFunc result for job id Q96F86

User Input

>input (508 residues)
MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDIT
ELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKR
TDVKSQDVAVSPQQQQCSKSYVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLK
NGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNER
PTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLT
LERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQGISCGRHLANH
DVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR
DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIG
IPQQVFQEVGINYHSPFGCKFVIPLHSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96F86	1.000	1.000	1.129E-100	508	1.000	1.000	Q96F86.pdb.gz	EDC3_HUMAN Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1
2	AFDB:Q21740	0.290	0.263	5.978E-18	566	0.187	0.168	Q21740.pdb.gz	Q21740_CAEEL DFDF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=edc-3 PE=1 SV=1
3	PDB:3rnoA	0.376	0.776	2.633E-11	233	0.093	0.202	3rnoA.pdb.gz	Identification of unknown protein function using metabolite cocktail screening.
4	PDB:1jztA	0.356	0.697	7.004E-11	243	0.093	0.193	1jztA.pdb.gz
5	PDB:3jb9E	0.117	0.515	7.182E-4	98	0.035	0.184	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
6	PDB:6g90d	0.101	0.460	1.590E-3	93	0.031	0.172	6g90d.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
7	PDB:1sc6D	0.180	0.225	1.797E-3	384	0.063	0.083	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase
8	PDB:6v4xG	0.112	0.656	1.797E-3	77	0.024	0.156	6v4xG.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
9	PDB:4kdcA	0.181	0.377	2.031E-3	217	0.055	0.129	4kdcA.pdb.gz
10	PDB:3swnQ	0.111	0.648	2.159E-3	73	0.030	0.205	3swnQ.pdb.gz	Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
11	PDB:3jb9D	0.108	0.486	2.594E-3	96	0.033	0.177	3jb9D.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	PDB:7b9vq	0.110	0.612	2.594E-3	75	0.024	0.160	7b9vq.pdb.gz	Structural basis for conformational equilibrium of the catalytic spliceosome.
13	AFDB:O04716	0.101	0.042	1.708E-2	1324	0.075	0.029	O04716.pdb.gz	MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana OX=3702 GN=MSH6 PE=1 SV=2
14	AFDB:Q14739	0.091	0.077	1.930E-2	615	0.093	0.076	Q14739.pdb.gz	LBR_HUMAN Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2
15	AFDB:Q9LUS2	0.093	0.054	1.930E-2	1089	0.132	0.062	Q9LUS2.pdb.gz	TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC120 PE=1 SV=1
16	AFDB:Q4VY51	0.147	0.091	4.020E-2	894	0.112	0.064	Q4VY51.pdb.gz	SYM8_PEA Probable ion channel SYM8 OS=Pisum sativum OX=3888 GN=SYM8 PE=1 SV=3
17	AFDB:Q9CAN3	0.161	0.130	4.020E-2	658	0.118	0.091	Q9CAN3.pdb.gz	SCL28_ARATH Scarecrow-like protein 28 OS=Arabidopsis thaliana OX=3702 GN=SCL28 PE=1 SV=1
18	AFDB:Q9U720	0.091	0.048	4.274E-2	1059	0.094	0.045	Q9U720.pdb.gz	DCSA_DICDI Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
19	AFDB:A8MRD9	0.107	0.069	5.134E-2	826	0.073	0.045	A8MRD9.pdb.gz	PDS5D_ARATH Sister chromatid cohesion protein PDS5 homolog D OS=Arabidopsis thaliana OX=3702 GN=PDS5D PE=2 SV=3
20	AFDB:Q6NQK2	0.068	0.076	1.069E-1	449	0.083	0.094	Q6NQK2.pdb.gz	NAC8_ARATH SUPPRESSOR OF GAMMA RESPONSE 1 OS=Arabidopsis thaliana OX=3702 GN=SOG1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96F86	0.0	1055	508	1.000	1.000	EDC3_HUMAN Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1
2	H3BPN4	1.90e-125	366	213	0.348	0.831	H3BPN4_HUMAN YjeF domain-containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1
3	H3BSQ0	2.47e-116	341	163	0.321	1.000	H3BSQ0_HUMAN Enhancer of mRNA decapping 3 (Fragment) OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1
4	Q9VVI2	6.86e-53	192	680	0.248	0.185	EDC3_DROME Enhancer of mRNA-decapping protein 3 OS=Drosophila melanogaster OX=7227 GN=Edc3 PE=1 SV=1
5	A0A1D8PM93	9.92e-21	97.4	512	0.189	0.188	A0A1D8PM93_CANAL Enhancer of mRNA-decapping protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EDC3 PE=3 SV=1
6	O94752	1.35e-15	81.3	454	0.157	0.176	EDC3_SCHPO Enhancer of mRNA-decapping protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=edc3 PE=1 SV=1
7	Q5AXT7	2.05e-09	62.4	698	0.146	0.106	Q5AXT7_EMENI Enhancer of mRNA-decapping protein 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06893 PE=3 SV=1
8	Q1LVI2	0.003	42.0	246	0.055	0.114	YJEN3_DANRE YjeF N-terminal domain-containing 3 OS=Danio rerio OX=7955 GN=yjefn3 PE=1 SV=1
9	Q0PIT9	0.050	38.1	288	0.077	0.135	NNRE_PIG NAD(P)H-hydrate epimerase OS=Sus scrofa OX=9823 GN=NAXE PE=2 SV=1
10	Q8NCW5	0.068	37.7	288	0.053	0.094	NNRE_HUMAN NAD(P)H-hydrate epimerase OS=Homo sapiens OX=9606 GN=NAXE PE=1 SV=2
11	B0BNM1	0.088	37.4	282	0.039	0.071	NNRE_RAT NAD(P)H-hydrate epimerase OS=Rattus norvegicus OX=10116 GN=Naxe PE=2 SV=1
12	Q8K4Z3	0.095	37.4	282	0.039	0.071	NNRE_MOUSE NAD(P)H-hydrate epimerase OS=Mus musculus OX=10090 GN=Naxe PE=1 SV=1
13	A6XGL0	0.15	37.0	299	0.041	0.070	YJEN3_HUMAN YjeF N-terminal domain-containing protein 3 OS=Homo sapiens OX=9606 GN=YJEFN3 PE=1 SV=1
14	Q6FT51	0.16	36.6	246	0.043	0.089	Q6FT51_CANGA NAD(P)H-hydrate epimerase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G05357g PE=3 SV=1
15	P40165	0.43	35.0	246	0.093	0.191	NNRE_YEAST NAD(P)H-hydrate epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNR1 PE=1 SV=1
16	Q9I689	1.4	33.9	639	0.061	0.049	Q9I689_PSEAE ATP-dependent RNA helicase RhlE OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=rhlE PE=3 SV=1
17	Q8K0T2	2.2	33.1	351	0.043	0.063	DC2L1_MOUSE Cytoplasmic dynein 2 light intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2li1 PE=1 SV=1
18	Q6AY43	3.7	32.3	351	0.041	0.060	DC2L1_RAT Cytoplasmic dynein 2 light intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2li1 PE=1 SV=2
19	Q21740	6.6	32.0	566	0.035	0.032	Q21740_CAEEL DFDF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=edc-3 PE=1 SV=1
20	Q7KSN0	8.2	31.6	1081	0.043	0.020	Q7KSN0_DROME SD10773p OS=Drosophila melanogaster OX=7227 GN=MBD-R2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17019 DUF5096	2.7e+02	12.8	Domain of unknown function (DUF5096)
2	PF16598 Edc3_linker	7.8e-46	165.8	Linker region of enhancer of mRNA-decapping protein 3
3	PF09532 FDF	9.2e-16	70.0	FDF domain
4	PF12701 LSM14	4.7e-07	41.1	Scd6-like Sm domain
5	PF03853 YjeF_N	3e-16	71.3	YjeF-related protein N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320503

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373715	0.999	m7GpppN-mRNA hydrolase
2	9606.ENSP00000476046	0.999	mRNA-decapping enzyme 1A
3	9606.ENSP00000478754	0.999	Probable ATP-dependent RNA helicase DDX6
4	9606.ENSP00000280665	0.998	mRNA-decapping enzyme 1B
5	9606.ENSP00000351811	0.998	Enhancer of mRNA-decapping protein 4
6	9606.ENSP00000310596	0.997	U6 snRNA-associated Sm-like protein LSm1
7	9606.ENSP00000469468	0.994	U6 snRNA-associated Sm-like protein LSm4
8	9606.ENSP00000300146	0.992	Protein PAT1 homolog 1
9	9606.ENSP00000264951	0.987	5'-3' exoribonuclease 1
10	9606.ENSP00000252622	0.982	U6 snRNA-associated Sm-like protein LSm7
11	9606.ENSP00000364813	0.982	U6 snRNA-associated Sm-like protein LSm2
12	9606.ENSP00000302160	0.981	U6 snRNA-associated Sm-like protein LSm3
13	9606.ENSP00000446271	0.969	Protein LSM14 homolog A
14	9606.ENSP00000472469	0.968	Ribosomal protein S28
15	9606.ENSP00000410758	0.957	U6 snRNA-associated Sm-like protein LSm5
16	9606.ENSP00000422392	0.951	U6 snRNA-associated Sm-like protein LSm6
17	9606.ENSP00000470142	0.927	Regulator of nonsense transcripts 1
18	9606.ENSP00000469647	0.896	mRNA decay activator protein ZFP36
19	9606.ENSP00000362608	0.881	Serine/threonine-protein kinase pim-1
20	9606.ENSP00000320949	0.840	CCR4-NOT transcription complex subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003676	0.825	nucleic acid binding
GO:0003723	0.684	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0006139	0.990	nucleobase-containing compound metabolic process
GO:0048519	0.976	negative regulation of biological process
GO:0044260	0.969	cellular macromolecule metabolic process
GO:0016070	0.957	RNA metabolic process
GO:0009056	0.938	catabolic process
GO:0044248	0.932	cellular catabolic process
GO:0010468	0.916	regulation of gene expression
GO:0050794	0.855	regulation of cellular process
GO:1901575	0.844	organic substance catabolic process
GO:0009892	0.804	negative regulation of metabolic process
GO:0010605	0.783	negative regulation of macromolecule metabolic process
GO:0010629	0.742	negative regulation of gene expression
GO:0016071	0.729	mRNA metabolic process
GO:0034655	0.693	nucleobase-containing compound catabolic process
GO:0006402	0.675	mRNA catabolic process
GO:0051171	0.503	regulation of nitrogen compound metabolic process
GO:0080090	0.491	regulation of primary metabolic process
GO:0031323	0.446	regulation of cellular metabolic process
GO:0048523	0.398	negative regulation of cellular process
GO:0071840	0.394	cellular component organization or biogenesis
GO:0048518	0.393	positive regulation of biological process
GO:0048522	0.338	positive regulation of cellular process
GO:0051246	0.337	regulation of protein metabolic process
GO:0010608	0.325	post-transcriptional regulation of gene expression
GO:0019219	0.306	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0036464	0.999	cytoplasmic ribonucleoprotein granule
GO:0016020	0.998	membrane
GO:0043231	0.946	intracellular membrane-bounded organelle
GO:0032991	0.939	protein-containing complex
GO:0070013	0.934	intracellular organelle lumen
GO:0005634	0.837	nucleus
GO:0031981	0.809	nuclear lumen
GO:0005654	0.734	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]