StarFunc result for job id Q96FA3

User Input

>input (418 residues)
MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIA
CTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPG
SQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQM
DGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQD
GSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVV
DEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPP
THAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4QN36	0.977	0.961	1.869E-84	425	0.907	0.892	A4QN36.pdb.gz	A4QN36_DANRE Pellino E3 ubiquitin protein ligase 1b OS=Danio rerio OX=7955 GN=zgc:153297 PE=2 SV=1
2	AFDB:Q9HAT8	0.972	0.968	4.499E-77	420	0.818	0.814	Q9HAT8.pdb.gz	PELI2_HUMAN E3 ubiquitin-protein ligase pellino homolog 2 OS=Homo sapiens OX=9606 GN=PELI2 PE=1 SV=1
3	AFDB:Q8N2H9	0.959	0.856	2.782E-71	469	0.701	0.625	Q8N2H9.pdb.gz	PELI3_HUMAN E3 ubiquitin-protein ligase pellino homolog 3 OS=Homo sapiens OX=9606 GN=PELI3 PE=1 SV=2
4	AFDB:O77237	0.936	0.923	2.467E-62	424	0.589	0.580	O77237.pdb.gz	PELI_DROME Protein pellino OS=Drosophila melanogaster OX=7227 GN=Pli PE=1 SV=1
5	AFDB:A7UA95	0.159	0.069	1.283E-2	1124	0.084	0.031	A7UA95.pdb.gz	RADIL_DANRE Ras-associating and dilute domain-containing protein OS=Danio rerio OX=7955 GN=radil PE=2 SV=1
6	AFDB:Q10322	0.168	0.242	1.881E-2	267	0.091	0.142	Q10322.pdb.gz	DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dma1 PE=1 SV=1
7	AFDB:P22216	0.164	0.087	2.612E-2	821	0.060	0.030	P22216.pdb.gz	RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD53 PE=1 SV=1
8	AFDB:Q69Z89	0.179	0.077	2.913E-2	1099	0.074	0.028	Q69Z89.pdb.gz	RADIL_MOUSE Ras-associating and dilute domain-containing protein OS=Mus musculus OX=10090 GN=Radil PE=1 SV=2
9	AFDB:P41813	0.148	0.079	3.077E-2	862	0.053	0.026	P41813.pdb.gz	FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKH2 PE=1 SV=1
10	AFDB:O14270	0.189	0.114	4.044E-2	743	0.086	0.048	O14270.pdb.gz	FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fhl1 PE=3 SV=2
11	PDB:7dvqX	0.127	0.298	4.705E-2	156	0.036	0.096	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:2ff4A	0.140	0.154	8.583E-2	379	0.053	0.058	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
13	PDB:3ffzA	0.087	0.045	2.173E-1	1246	0.072	0.024	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
14	PDB:5k1bA	0.066	0.088	2.704E-1	264	0.041	0.064	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:2kb3A	0.142	0.363	3.186E-1	143	0.057	0.168	2kb3A.pdb.gz
16	PDB:3zwlD	0.074	0.083	3.365E-1	352	0.067	0.080	3zwlD.pdb.gz
17	PDB:5wq8A	0.119	0.108	3.365E-1	496	0.081	0.069	5wq8A.pdb.gz
18	PDB:7ajuUL	0.052	0.034	4.934E-1	779	0.033	0.018	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:6l9wD	0.143	0.358	6.139E-1	142	0.033	0.099	6l9wD.pdb.gz
20	PDB:5fb4C	0.068	0.058	9.000E-1	516	0.086	0.070	5fb4C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4QN36	0.0	807	425	0.907	0.892	A4QN36_DANRE Pellino E3 ubiquitin protein ligase 1b OS=Danio rerio OX=7955 GN=zgc:153297 PE=2 SV=1
2	Q8BST6	0.0	719	419	0.797	0.795	PELI2_MOUSE E3 ubiquitin-protein ligase pellino homolog 2 OS=Mus musculus OX=10090 GN=Peli2 PE=1 SV=2
3	Q8BXR6	0.0	606	445	0.699	0.656	PELI3_MOUSE E3 ubiquitin-protein ligase pellino homolog 3 OS=Mus musculus OX=10090 GN=Peli3 PE=1 SV=2
4	Q8C669	0.0	879	418	0.998	0.998	PELI1_MOUSE E3 ubiquitin-protein ligase pellino homolog 1 OS=Mus musculus OX=10090 GN=Peli1 PE=1 SV=2
5	Q8N2H9	0.0	596	469	0.703	0.627	PELI3_HUMAN E3 ubiquitin-protein ligase pellino homolog 3 OS=Homo sapiens OX=9606 GN=PELI3 PE=1 SV=2
6	Q96FA3	0.0	881	418	1.000	1.000	PELI1_HUMAN E3 ubiquitin-protein ligase pellino homolog 1 OS=Homo sapiens OX=9606 GN=PELI1 PE=1 SV=2
7	Q9HAT8	0.0	740	420	0.818	0.814	PELI2_HUMAN E3 ubiquitin-protein ligase pellino homolog 2 OS=Homo sapiens OX=9606 GN=PELI2 PE=1 SV=1
8	O77237	6.02e-179	507	424	0.591	0.583	PELI_DROME Protein pellino OS=Drosophila melanogaster OX=7227 GN=Pli PE=1 SV=1
9	O13724	1.6	33.5	459	0.026	0.024	ZPR1_SCHPO Zinc finger chaperone zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zpr1 PE=3 SV=1
10	Q581Z8	2.0	33.5	2063	0.065	0.013	Q581Z8_TRYB2 SEC7 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.250 PE=4 SV=1
11	K9N643	2.7	32.3	246	0.057	0.098	ORF4B_MERS1 Non-structural protein ORF4b OS=Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) OX=1263720 GN=ORF4b PE=1 SV=1
12	P92934	3.4	32.3	481	0.069	0.060	AAP6_ARATH Amino acid permease 6 OS=Arabidopsis thaliana OX=3702 GN=AAP6 PE=1 SV=1
13	Q5BG90	4.9	32.0	659	0.041	0.026	Q5BG90_EMENI Transcriptional regulator Ngg1, putative (AFU_orthologue AFUA_1G04590) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00440 PE=3 SV=1
14	Q47CX0	5.5	31.6	282	0.041	0.060	CLD_DECAR Chlorite dismutase OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=Daro_2580 PE=1 SV=1
15	Q38DY9	6.4	29.3	82	0.053	0.268	Q38DY9_TRYB2 Anaphase-promoting complex subunit 11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1655 PE=4 SV=1
16	Q57ZN7	7.0	31.6	871	0.043	0.021	Q57ZN7_TRYB2 MYND-like zinc finger domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.70 PE=4 SV=1
17	D3ZW88	8.4	31.2	1549	0.038	0.010	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04710 Pellino	6.4e-221	744.9	Pellino
2	PF14447 Prok-RING_4	49	15.2	Prokaryotic RING finger family 4
3	PF13920 zf-C3HC4_3	91	14.3	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010608046.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010626358.1	0.972	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
2	885580.XP_010613700.1	0.933	Interleukin-1 receptor-associated kinase 4 isoform X1
3	885580.XP_010610864.1	0.913	Belongs to the TNF receptor-associated factor family.
4	885580.XP_010631527.1	0.762	Mitogen-activated protein kinase kinase kinase 7 isoform X1
5	885580.XP_010606025.1	0.710	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
6	885580.XP_010621058.1	0.710	Receptor-interacting serine/threonine-protein kinase 1
7	885580.XP_010627528.1	0.697	Ubiquitin-conjugating enzyme E2 N
8	885580.XP_010610998.1	0.671	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
9	885580.XP_010627774.1	0.651	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
10	885580.XP_010610494.1	0.646	Tumor necrosis factor receptor type 1-associated DEATH domain protein
11	885580.XP_010636838.1	0.612	Inhibitor of nuclear factor kappa-B kinase subunit alpha
12	885580.XP_010615396.1	0.600	Inhibitor of nuclear factor kappa-B kinase subunit beta
13	885580.XP_010617995.1	0.573	Interleukin-1 receptor-associated kinase-like 2
14	885580.XP_010611396.1	0.563	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
15	885580.XP_010637097.1	0.562	NF-kappa-B essential modulator isoform X1
16	885580.XP_010627504.1	0.546	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
17	885580.XP_010639779.1	0.546	E3 ubiquitin-protein ligase RNF138
18	885580.XP_010613651.1	0.520	Belongs to the protein kinase superfamily.
19	885580.XP_010605562.1	0.517	Belongs to the TNF receptor-associated factor family.
20	885580.XP_010616529.1	0.503	Ubiquitin-conjugating enzyme E2 variant 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0034450	0.308	ubiquitin-ubiquitin ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0043123	0.986	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043170	0.985	macromolecule metabolic process
GO:0009987	0.983	cellular process
GO:0000209	0.981	protein polyubiquitination
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0048519	0.966	negative regulation of biological process
GO:0048523	0.962	negative regulation of cellular process
GO:0051252	0.959	regulation of RNA metabolic process
GO:0010556	0.958	regulation of macromolecule biosynthetic process
GO:0031326	0.958	regulation of cellular biosynthetic process
GO:0070936	0.954	protein K48-linked ubiquitination
GO:0010941	0.946	regulation of cell death
GO:0009607	0.945	response to biotic stimulus
GO:0042221	0.941	response to chemical
GO:2001141	0.940	regulation of RNA biosynthetic process
GO:0051707	0.936	response to other organism
GO:0010033	0.933	response to organic substance
GO:0065009	0.889	regulation of molecular function
GO:0043067	0.883	regulation of programmed cell death
GO:0044237	0.871	cellular metabolic process
GO:0006355	0.871	regulation of DNA-templated transcription
GO:0032496	0.862	response to lipopolysaccharide
GO:0002682	0.839	regulation of immune system process
GO:0051239	0.817	regulation of multicellular organismal process
GO:0051090	0.806	regulation of DNA-binding transcription factor activity
GO:0051174	0.803	regulation of phosphorus metabolic process
GO:0031325	0.800	positive regulation of cellular metabolic process
GO:0080134	0.798	regulation of response to stress
GO:0031401	0.791	positive regulation of protein modification process
GO:0042127	0.788	regulation of cell population proliferation
GO:0031349	0.773	positive regulation of defense response
GO:0051716	0.772	cellular response to stimulus
GO:0002376	0.760	immune system process
GO:0050778	0.753	positive regulation of immune response
GO:0060548	0.727	negative regulation of cell death
GO:0032103	0.718	positive regulation of response to external stimulus
GO:0043069	0.711	negative regulation of programmed cell death
GO:0002831	0.704	regulation of response to biotic stimulus
GO:0010939	0.703	regulation of necrotic cell death
GO:0002683	0.686	negative regulation of immune system process
GO:0007165	0.674	signal transduction
GO:0070663	0.664	regulation of leukocyte proliferation
GO:0042981	0.660	regulation of apoptotic process
GO:0045088	0.638	regulation of innate immune response
GO:0002833	0.626	positive regulation of response to biotic stimulus
GO:0050865	0.613	regulation of cell activation
GO:0001817	0.608	regulation of cytokine production
GO:0032944	0.602	regulation of mononuclear cell proliferation
GO:0032501	0.598	multicellular organismal process
GO:0045089	0.565	positive regulation of innate immune response
GO:0002694	0.542	regulation of leukocyte activation
GO:0051241	0.541	negative regulation of multicellular organismal process
GO:0032945	0.536	negative regulation of mononuclear cell proliferation
GO:0042325	0.503	regulation of phosphorylation
GO:0006950	0.480	response to stress
GO:0051240	0.470	positive regulation of multicellular organismal process
GO:0010562	0.461	positive regulation of phosphorus metabolic process
GO:0051249	0.452	regulation of lymphocyte activation
GO:0045937	0.445	positive regulation of phosphate metabolic process
GO:0050672	0.439	negative regulation of lymphocyte proliferation
GO:0030155	0.374	regulation of cell adhesion
GO:0042327	0.350	positive regulation of phosphorylation
GO:0070887	0.344	cellular response to chemical stimulus
GO:0001934	0.343	positive regulation of protein phosphorylation
GO:0010628	0.339	positive regulation of gene expression
GO:1903320	0.310	regulation of protein modification by small protein conjugation or removal
GO:0071310	0.309	cellular response to organic substance
GO:0022407	0.301	regulation of cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0005634	0.968	nucleus
GO:0031981	0.940	nuclear lumen
GO:0005654	0.880	nucleoplasm
GO:0016020	0.461	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]