StarFunc result for job id Q96FC9

User Input

>input (970 residues)
MANETQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSLICGALS
WLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQK
KEERDLVDRLKAEQARRKQREERLQQLQHRVQLKYAAKRLRQEEEERENLLRLSREMLET
GPEAERLEQLESGEEELVLAEYESDEEKKVASRVDEDEDDLEEEHITKIYYCSRTHSQLA
QFVHEVKKSPFGKDVRLVSLGSRQNLCVNEDVKSLGSVQLINDRCVDMQRSRHEKKKGAE
EEKPKRRRQEKQAACPFYNHEQMGLLRDEALAEVKDMEQLLALGKEARACPYYGSRLAIP
AAQLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDTITGMHSVEVSGSQLCQAHS
QLLQYVERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQNPNTQSLSQTGTELKTIND
FLFQSQIDNINLFKVQRYCEKSMISRKLFGFTERYGAVFSSREQPKLAGFQQFLQSLQPR
TTEALAAPADESQASTLRPASPLMHIQGFLAALTTANQDGRVILSRQGSLSQSTLKFLLL
NPAVHFAQVVKECRAVVIAGGTMQPVSDFRQQLLACAGVEAERVVEFSCGHVIPPDNILP
LVICSGISNQPLEFTFQKRELPQMMDEVGRILCNLCGVVPGGVVCFFPSYEYLRQVHAHW
EKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTGALLLSVVGGKMS
EGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLSPRPGTPREGSGGEPVHEGRQ
PVHRQGHQAPEGFCQRSAPGPAICPAPCPGQAAGLDPSPCGGQSYLWPRHCCCAEVSPGE
VGLFLMGNHTTAWRRALPLSCPLETVFVVGVVCGDPVTKVKPRRRVWSPECCQDPGTGVS
SRRRKWGNPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FC9	1.000	1.000	0.000	970	1.000	1.000	Q96FC9.pdb.gz	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
2	AFDB:F1R345	0.744	0.808	2.102E-91	890	0.507	0.553	F1R345.pdb.gz	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
3	AFDB:O14147	0.625	0.714	2.470E-54	844	0.276	0.318	O14147.pdb.gz	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
4	AFDB:P22516	0.578	0.645	3.107E-52	861	0.264	0.297	P22516.pdb.gz	CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHL1 PE=1 SV=1
5	AFDB:Q9BX63	0.493	0.389	1.249E-40	1249	0.223	0.173	Q9BX63.pdb.gz	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
6	AFDB:A0A0G2K475	0.505	0.424	1.537E-40	1166	0.237	0.197	A0A0G2K475.pdb.gz	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
7	AFDB:Q9W484	0.535	0.528	1.005E-36	985	0.168	0.165	Q9W484.pdb.gz	RTEL1_DROME Regulator of telomere elongation helicase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Rtel1 PE=1 SV=1
8	AFDB:Q9NZ71	0.552	0.445	1.975E-36	1219	0.210	0.167	Q9NZ71.pdb.gz	RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2
9	AFDB:Q93575	0.535	0.522	4.469E-35	994	0.170	0.166	Q93575.pdb.gz	RTEL1_CAEEL Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rtel-1 PE=3 SV=3
10	AFDB:F4HQE2	0.527	0.493	2.756E-34	1040	0.188	0.175	F4HQE2.pdb.gz	RTEL1_ARATH Regulator of telomere elongation helicase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=RTEL1 PE=3 SV=1
11	PDB:7ad8B	0.522	0.738	1.100E-28	675	0.170	0.244	7ad8B.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:7lbmX	0.453	0.571	1.767E-25	760	0.147	0.188	7lbmX.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
13	PDB:7k010	0.454	0.577	5.840E-25	754	0.140	0.180	7k010.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
14	PDB:5fmfY	0.363	0.579	4.108E-19	578	0.105	0.176	5fmfY.pdb.gz	Structure of an RNA Polymerase II Pre-Initiation Complex
15	PDB:6fwrA	0.428	0.579	9.153E-17	699	0.095	0.132	6fwrA.pdb.gz	DNA translocation mechanism of an XPD family helicase.
16	PDB:5svaY	0.362	0.593	1.799E-16	562	0.120	0.206	5svaY.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:3crvA	0.328	0.535	1.151E-14	551	0.088	0.154	3crvA.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
18	PDB:3crw1	0.292	0.535	3.226E-10	485	0.078	0.157	3crw1.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
19	PDB:2vdaA	0.154	0.176	1.309E-2	828	0.054	0.063	2vdaA.pdb.gz	Structural Basis for Signal-Sequence Recognition by the Translocase Motor Seca as Determined by NMR
20	PDB:6goxA	0.158	0.187	1.697E-2	777	0.049	0.062	6goxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MPP1	0.0	1630	907	0.829	0.886	D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens OX=9606 GN=DDX11L8 PE=1 SV=1
2	C9K0E8	0.0	600	302	0.311	1.000	C9K0E8_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=2
3	F1R345	0.0	988	890	0.506	0.552	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
4	Q96FC9	0.0	1995	970	1.000	1.000	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
5	F5GXJ8	1.28e-150	446	224	0.231	1.000	F5GXJ8_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
6	O14147	6.79e-146	456	844	0.288	0.331	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
7	Q9CA92	4.12e-145	456	882	0.307	0.338	Q9CA92_ARATH DNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g79890 PE=1 SV=1
8	Q21489	2.40e-126	405	830	0.294	0.343	CHL1_CAEEL ATP-dependent DNA helicase chl-1 OS=Caenorhabditis elegans OX=6239 GN=chl-1 PE=3 SV=2
9	P22516	1.74e-116	379	861	0.280	0.316	CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHL1 PE=1 SV=1
10	F5GXL6	2.64e-103	322	191	0.160	0.812	F5GXL6_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=4 SV=8
11	A0A0G2K475	2.04e-67	248	1166	0.229	0.190	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
12	Q3YK19	8.92e-61	228	1252	0.238	0.185	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
13	Q5SXJ3	3.16e-57	217	1174	0.175	0.145	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
14	Q9BX63	1.07e-55	213	1249	0.172	0.134	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
15	R4GNE1	8.37e-54	184	91	0.092	0.978	R4GNE1_HUMAN DEAD/H-box helicase 11 (Fragment) OS=Homo sapiens OX=9606 GN=DDX11 PE=4 SV=1
16	F4HUN4	1.97e-48	189	1175	0.168	0.139	F4HUN4_ARATH RAD3-like DNA-binding helicase protein OS=Arabidopsis thaliana OX=3702 GN=At1g20720 PE=1 SV=1
17	Q38BP4	2.16e-48	189	1056	0.205	0.188	Q38BP4_TRYB2 DNA repair helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3870 PE=4 SV=1
18	Q9NZ71	1.33e-47	187	1219	0.166	0.132	RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2
19	P26659	2.15e-39	159	772	0.152	0.190	RAD15_SCHPO General transcription and DNA repair factor IIH helicase subunit XPD OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad15 PE=1 SV=2
20	F4HQE2	2.54e-39	160	1040	0.154	0.143	RTEL1_ARATH Regulator of telomere elongation helicase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=RTEL1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	9.9e+02	11.4	AAA domain
2	PF06733 DEAD_2	1.2e-52	189.6	DEAD_2
3	PF06777 HBB	0.39	21.9	Helical and beta-bridge domain
4	PF13307 Helicase_C_2	6.2e-30	116.1	Helicase C-terminal domain
5	PF02562 PhoH	2.8e+02	12.4	PhoH-like protein
6	PF04851 ResIII	11	17.5	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262315	0.985	Chromosome transmission fidelity protein 18 homolog
2	9606.ENSP00000305480	0.983	Flap endonuclease 1
3	9606.ENSP00000450607	0.966	Protein timeless homolog
4	9606.ENSP00000353793	0.933	WD repeat and HMG-box DNA-binding protein 1
5	9606.ENSP00000354720	0.931	Structural maintenance of chromosomes protein 3
6	9606.ENSP00000216037	0.900	X-box-binding protein 1
7	9606.ENSP00000269214	0.875	N-acetyltransferase ESCO1
8	9606.ENSP00000322180	0.869	Sister chromatid cohesion protein DCC1
9	9606.ENSP00000306999	0.866	N-acetyltransferase ESCO2
10	9606.ENSP00000263377	0.848	Bromodomain-containing protein 4
11	9606.ENSP00000282516	0.808	Nipped-B-like protein
12	9606.ENSP00000313171	0.773	ATPase family AAA domain-containing protein 5
13	9606.ENSP00000410584	0.767	CUGBP Elav-like family member 4
14	9606.ENSP00000261881	0.745	TIMELESS-interacting protein
15	9606.ENSP00000281474	0.735	Protein bicaudal D homolog 1
16	9606.ENSP00000297338	0.722	Double-strand-break repair protein rad21 homolog
17	9606.ENSP00000262039	0.711	Phosphatidylinositol 3-kinase catalytic subunit type 3
18	9606.ENSP00000298139	0.707	Werner syndrome ATP-dependent helicase
19	9606.ENSP00000426191	0.700	Cell cycle checkpoint protein RAD17
20	9606.ENSP00000350698	0.692	Probable ATP-dependent RNA helicase DDX47

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008186	1.000	ATP-dependent activity, acting on RNA
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003727	1.000	single-stranded RNA binding
GO:0003697	1.000	single-stranded DNA binding
GO:0003688	1.000	DNA replication origin binding
GO:0043139	0.999	5'-3' DNA helicase activity
GO:0045142	0.703	triplex DNA binding
GO:0051880	0.679	G-quadruplex DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0044237	0.980	cellular metabolic process
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0090304	0.973	nucleic acid metabolic process
GO:0019222	0.971	regulation of metabolic process
GO:0044260	0.969	cellular macromolecule metabolic process
GO:0080090	0.963	regulation of primary metabolic process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0006259	0.963	DNA metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0050896	0.952	response to stimulus
GO:0019219	0.952	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.943	cellular response to stimulus
GO:0060255	0.943	regulation of macromolecule metabolic process
GO:0033554	0.921	cellular response to stress
GO:0006356	0.915	regulation of transcription by RNA polymerase I
GO:0033044	0.913	regulation of chromosome organization
GO:0071840	0.909	cellular component organization or biogenesis
GO:0065009	0.908	regulation of molecular function
GO:0006282	0.907	regulation of DNA repair
GO:0051054	0.901	positive regulation of DNA metabolic process
GO:0006974	0.900	cellular response to DNA damage stimulus
GO:0016043	0.884	cellular component organization
GO:0006260	0.882	DNA replication
GO:0022402	0.871	cell cycle process
GO:0006996	0.858	organelle organization
GO:0051276	0.852	chromosome organization
GO:0006261	0.794	DNA-templated DNA replication
GO:0032392	0.787	DNA geometric change
GO:2001022	0.764	positive regulation of response to DNA damage stimulus
GO:0010557	0.755	positive regulation of macromolecule biosynthetic process
GO:0140747	0.754	regulation of ncRNA transcription
GO:0051098	0.740	regulation of binding
GO:0031328	0.669	positive regulation of cellular biosynthetic process
GO:0051726	0.583	regulation of cell cycle
GO:1902680	0.545	positive regulation of RNA biosynthetic process
GO:0045739	0.538	positive regulation of DNA repair
GO:0032508	0.530	DNA duplex unwinding
GO:0045893	0.511	positive regulation of DNA-templated transcription
GO:2000779	0.486	regulation of double-strand break repair
GO:0010564	0.415	regulation of cell cycle process
GO:0044093	0.340	positive regulation of molecular function
GO:0006325	0.340	chromatin organization
GO:0045005	0.326	DNA-templated DNA replication maintenance of fidelity
GO:0031297	0.306	replication fork processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0005694	0.981	chromosome
GO:0005856	0.947	cytoskeleton
GO:0140513	0.929	nuclear protein-containing complex
GO:0005730	0.848	nucleolus
GO:0000785	0.795	chromatin
GO:0005576	0.755	extracellular region
GO:0031982	0.743	vesicle
GO:0005819	0.719	spindle
GO:0005815	0.680	microtubule organizing center
GO:0005813	0.665	centrosome
GO:0005737	0.599	cytoplasm
GO:0005615	0.548	extracellular space
GO:1903561	0.495	extracellular vesicle
GO:0005829	0.432	cytosol
GO:0070062	0.413	extracellular exosome
GO:0031390	0.395	Ctf18 RFC-like complex
GO:0030496	0.381	midbody
GO:0000922	0.332	spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.3	0.999	DNA 5'-3' helicase.

[back to server]