StarFunc result for job id Q96FE7

User Input

>input (263 residues)
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGTTPLMGQAGTPGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FE7	1.000	1.000	4.880E-43	263	1.000	1.000	Q96FE7.pdb.gz	P3IP1_HUMAN Phosphoinositide-3-kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PIK3IP1 PE=1 SV=2
2	AFDB:Q7TMJ8	0.340	0.339	3.340E-31	264	0.791	0.788	Q7TMJ8.pdb.gz	P3IP1_MOUSE Phosphoinositide-3-kinase-interacting protein 1 OS=Mus musculus OX=10090 GN=Pik3ip1 PE=2 SV=1
3	PDB:5edmA	0.240	0.123	4.510E-4	550	0.110	0.053	5edmA.pdb.gz	How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
4	PDB:4a5tS	0.242	0.089	2.189E-3	767	0.103	0.035	4a5tS.pdb.gz
5	PDB:4duuA	0.251	0.102	3.471E-3	682	0.087	0.034	4duuA.pdb.gz
6	PDB:6bjrA	0.252	0.124	7.160E-3	575	0.110	0.050	6bjrA.pdb.gz	Structure of prothrombin in the closed form reveals new details on the mechanism of activation.
7	AFDB:E9QGD4	0.098	0.040	3.255E-1	870	0.137	0.041	E9QGD4.pdb.gz	E9QGD4_DANRE Low density lipoprotein receptor a OS=Danio rerio OX=7955 GN=ldlr PE=4 SV=1
8	AFDB:P15083	0.101	0.045	3.965E-1	769	0.144	0.049	P15083.pdb.gz	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
9	AFDB:Q9VH89	0.085	0.032	4.523E-1	857	0.110	0.034	Q9VH89.pdb.gz	DALMA_DROME Protein dalmatian OS=Drosophila melanogaster OX=7227 GN=dmt PE=1 SV=1
10	AFDB:A0A1C6ZYS3	0.112	0.101	6.286E-1	295	0.110	0.098	A0A1C6ZYS3.pdb.gz	A0A1C6ZYS3_DANRE Hepatitis A virus cellular receptor 1 homolog isoform X4 OS=Danio rerio OX=7955 GN=zgc:92647 PE=2 SV=1
11	AFDB:O95944	0.205	0.196	8.736E-1	276	0.091	0.087	O95944.pdb.gz	NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 OS=Homo sapiens OX=9606 GN=NCR2 PE=1 SV=2
12	AFDB:A8WG81	0.130	0.108	9.330E-1	339	0.106	0.083	A8WG81.pdb.gz	A8WG81_DANRE Transmembrane protein 59-like OS=Danio rerio OX=7955 GN=wu:fi68e12 PE=2 SV=1
13	AFDB:P01832	0.126	0.054	9.330E-1	773	0.095	0.032	P01832.pdb.gz	PIGR_RABIT Polymeric immunoglobulin receptor OS=Oryctolagus cuniculus OX=9986 GN=PIGR PE=1 SV=1
14	AFDB:P41047	0.179	0.171	9.330E-1	279	0.084	0.079	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
15	PDB:7x3kB	0.095	0.054	2.058	506	0.046	0.024	7x3kB.pdb.gz
16	PDB:5zr6A	0.077	0.096	3.485	214	0.068	0.084	5zr6A.pdb.gz	Crystal structures of manganese-dependent transcriptional repressor MntR (Rv2788) from Mycobacterium tuberculosis in apo and manganese bound forms.
17	PDB:1dt9A	0.052	0.035	4.534	398	0.019	0.013	1dt9A.pdb.gz
18	PDB:2eyzA	0.065	0.056	4.534	304	0.030	0.026	2eyzA.pdb.gz
19	PDB:3lx2A	0.065	0.069	5.900	247	0.030	0.032	3lx2A.pdb.gz
20	PDB:7z1lI	0.054	0.107	5.900	110	0.030	0.073	7z1lI.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96FE7	0.0	545	263	1.000	1.000	P3IP1_HUMAN Phosphoinositide-3-kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PIK3IP1 PE=1 SV=2
2	Q7TMJ8	8.07e-148	415	264	0.791	0.788	P3IP1_MOUSE Phosphoinositide-3-kinase-interacting protein 1 OS=Mus musculus OX=10090 GN=Pik3ip1 PE=2 SV=1
3	Q28198	7.34e-09	58.2	566	0.125	0.058	TPA_BOVIN Tissue-type plasminogen activator OS=Bos taurus OX=9913 GN=PLAT PE=2 SV=1
4	P00750	6.62e-08	55.5	562	0.137	0.064	TPA_HUMAN Tissue-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAT PE=1 SV=1
5	Q9R098	8.30e-08	55.1	653	0.122	0.049	HGFA_MOUSE Hepatocyte growth factor activator OS=Mus musculus OX=10090 GN=Hgfac PE=1 SV=1
6	P19637	1.81e-07	53.9	559	0.171	0.081	TPA_RAT Tissue-type plasminogen activator OS=Rattus norvegicus OX=10116 GN=Plat PE=2 SV=2
7	P11214	3.30e-07	53.1	559	0.125	0.059	TPA_MOUSE Tissue-type plasminogen activator OS=Mus musculus OX=10090 GN=Plat PE=1 SV=3
8	Q04756	6.71e-07	52.4	655	0.118	0.047	HGFA_HUMAN Hepatocyte growth factor activator OS=Homo sapiens OX=9606 GN=HGFAC PE=1 SV=1
9	P00749	1.23e-06	51.2	431	0.106	0.065	UROK_HUMAN Urokinase-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAU PE=1 SV=3
10	F1REK1	1.97e-06	50.8	712	0.103	0.038	F1REK1_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
11	Q5RGG3	2.21e-06	50.8	699	0.103	0.039	Q5RGG3_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
12	F7FMS0	2.99e-06	50.4	739	0.122	0.043	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
13	P70521	3.25e-06	50.4	716	0.122	0.045	P70521_RAT Macrophage stimulating 1 (Hepatocyte growth factor-like) OS=Rattus norvegicus OX=10116 GN=Mst1 PE=2 SV=1
14	Q9TVA8	4.32e-06	47.8	157	0.106	0.178	Q9TVA8_BOVIN Urokinase plasminogen activator (Fragment) OS=Bos taurus OX=9913 PE=2 SV=1
15	P26928	6.30e-06	49.3	716	0.122	0.045	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
16	P00747	9.83e-06	48.9	810	0.118	0.038	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
17	Q05589	1.20e-05	48.1	433	0.106	0.065	UROK_BOVIN Urokinase-type plasminogen activator OS=Bos taurus OX=9913 GN=PLAU PE=2 SV=1
18	Q01177	3.57e-05	47.0	812	0.114	0.037	PLMN_RAT Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2
19	Q08048	3.78e-05	47.0	728	0.087	0.032	HGF_MOUSE Hepatocyte growth factor OS=Mus musculus OX=10090 GN=Hgf PE=1 SV=1
20	P14210	4.65e-05	46.6	728	0.087	0.032	HGF_HUMAN Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00051 Kringle	1.2e-06	40.0	Kringle domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215912

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337889	0.620	Max dimerization protein 4
2	9606.ENSP00000414022	0.566	PGC-1 and ERR-induced regulator in muscle protein 1
3	9606.ENSP00000340271	0.561	Transcription initiation factor TFIID subunit 3
4	9606.ENSP00000453281	0.520	DNA-binding protein RFX7
5	9606.ENSP00000365757	0.507	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043548	1.000	phosphatidylinositol 3-kinase binding
GO:0019900	1.000	kinase binding
GO:0036313	0.576	phosphatidylinositol 3-kinase catalytic subunit binding
GO:0003824	0.329	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0045833	0.983	negative regulation of lipid metabolic process
GO:0033673	0.982	negative regulation of kinase activity
GO:0043550	0.977	regulation of lipid kinase activity
GO:0014066	0.975	regulation of phosphatidylinositol 3-kinase signaling
GO:0023057	0.950	negative regulation of signaling
GO:0010648	0.949	negative regulation of cell communication
GO:0009968	0.931	negative regulation of signal transduction
GO:0043551	0.901	regulation of phosphatidylinositol 3-kinase activity
GO:1902532	0.824	negative regulation of intracellular signal transduction
GO:0009987	0.476	cellular process
GO:0048518	0.353	positive regulation of biological process
GO:0050896	0.330	response to stimulus
GO:0048522	0.313	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.995	cellular anatomical entity
GO:0016020	0.994	membrane
GO:0071944	0.974	cell periphery
GO:0005886	0.920	plasma membrane
GO:0005622	0.808	intracellular anatomical structure
GO:0005737	0.648	cytoplasm
GO:0031981	0.470	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]