StarFunc result for job id Q96FI4

User Input

>input (390 residues)
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKS
KATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPEAPTVPKKGRR
KGRQAASGHCRPRKVKADIPSLEPEGTSAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FI4	1.000	1.000	5.168E-74	390	1.000	1.000	Q96FI4.pdb.gz	NEIL1_HUMAN Endonuclease 8-like 1 OS=Homo sapiens OX=9606 GN=NEIL1 PE=1 SV=3
2	AFDB:Q8K4Q6	0.778	0.780	4.344E-62	389	0.795	0.797	Q8K4Q6.pdb.gz	NEIL1_MOUSE Endonuclease 8-like 1 OS=Mus musculus OX=10090 GN=Neil1 PE=2 SV=3
3	PDB:1tdhA	0.719	0.986	5.472E-53	284	0.723	0.993	1tdhA.pdb.gz
4	PDB:5itxA	0.667	0.983	5.164E-47	264	0.677	1.000	5itxA.pdb.gz	Tautomerization-dependent recognition and excision of oxidation damage in base-excision DNA repair
5	PDB:1k82A	0.513	0.748	2.047E-11	260	0.159	0.238	1k82A.pdb.gz	Structure of formamidopyrimidine-DNA glycosylase covalently complexed to DNA.
6	PDB:1q3bA	0.249	0.339	6.318E-8	259	0.141	0.212	1q3bA.pdb.gz	Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
7	AFDB:P16157	0.092	0.037	1.824E-2	1881	0.169	0.035	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
8	PDB:6rrrA	0.116	0.102	7.092E-2	472	0.100	0.083	6rrrA.pdb.gz
9	AFDB:O59722	0.088	0.032	9.202E-2	1932	0.159	0.032	O59722.pdb.gz	FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fab1 PE=1 SV=2
10	AFDB:A1A4S6	0.113	0.071	9.750E-2	786	0.156	0.078	A1A4S6.pdb.gz	RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens OX=9606 GN=ARHGAP10 PE=1 SV=1
11	AFDB:H3BLV9	0.099	0.065	1.379E-1	671	0.087	0.051	H3BLV9.pdb.gz	H3BLV9_HUMAN SRSF protein kinase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=1
12	PDB:5cskB	0.133	0.048	1.788E-1	2017	0.082	0.016	5cskB.pdb.gz
13	PDB:2kr0A	0.106	0.103	2.530E-1	407	0.026	0.025	2kr0A.pdb.gz
14	AFDB:Q9GN62	0.107	0.080	2.760E-1	617	0.169	0.107	Q9GN62.pdb.gz	PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans OX=6239 GN=par-4 PE=1 SV=2
15	PDB:4azqA	0.091	0.216	3.188E-1	136	0.013	0.037	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
16	PDB:3w9rA	0.104	0.194	3.377E-1	171	0.031	0.070	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.
17	AFDB:Q8IZD9	0.096	0.029	3.685E-1	2030	0.128	0.025	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
18	PDB:6serA	0.069	0.087	3.791E-1	245	0.033	0.053	6serA.pdb.gz
19	AFDB:M9NDZ1	0.097	0.054	7.373E-1	898	0.138	0.060	M9NDZ1.pdb.gz	M9NDZ1_DROME Serine-arginine protein kinase at 79D, isoform I OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
20	AFDB:A0A024RAQ8	0.083	0.094	9.844E-1	336	0.121	0.140	A0A024RAQ8.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K4Q6	0.0	619	389	0.795	0.797	NEIL1_MOUSE Endonuclease 8-like 1 OS=Mus musculus OX=10090 GN=Neil1 PE=2 SV=3
2	Q96FI4	0.0	790	390	1.000	1.000	NEIL1_HUMAN Endonuclease 8-like 1 OS=Homo sapiens OX=9606 GN=NEIL1 PE=1 SV=3
3	O80358	4.17e-07	53.9	390	0.164	0.164	FPG_ARATH Formamidopyrimidine-DNA glycosylase OS=Arabidopsis thaliana OX=3702 GN=FPG1 PE=1 SV=1
4	Q6R2P8	4.47e-06	50.4	329	0.108	0.128	NEIL2_MOUSE Endonuclease 8-like 2 OS=Mus musculus OX=10090 GN=Neil2 PE=2 SV=4
5	Q969S2	9.58e-06	49.3	332	0.108	0.127	NEIL2_HUMAN Endonuclease 8-like 2 OS=Homo sapiens OX=9606 GN=NEIL2 PE=1 SV=3
6	P9WNC3	8.97e-04	43.1	289	0.164	0.221	FPG1_MYCTU Formamidopyrimidine-DNA glycosylase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fpg1 PE=1 SV=1
7	Q8K203	0.003	42.4	606	0.100	0.064	NEIL3_MOUSE Endonuclease 8-like 3 OS=Mus musculus OX=10090 GN=Neil3 PE=1 SV=1
8	P50465	0.019	38.9	263	0.044	0.065	END8_ECOLI Endonuclease 8 OS=Escherichia coli (strain K12) OX=83333 GN=nei PE=1 SV=3
9	P05523	0.046	37.7	269	0.138	0.201	FPG_ECOLI Formamidopyrimidine-DNA glycosylase OS=Escherichia coli (strain K12) OX=83333 GN=mutM PE=1 SV=3
10	P9WNB9	0.066	37.4	268	0.044	0.063	END8A_MYCTU Endonuclease 8 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nei1 PE=1 SV=1
11	A0A1D8PPQ0	0.089	37.0	372	0.038	0.040	A0A1D8PPQ0_CANAL DNA-(apurinic or apyrimidinic site) lyase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FPG1 PE=3 SV=1
12	P9WNC1	0.10	36.6	255	0.046	0.071	END8B_MYCTU Endonuclease 8 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nei2 PE=3 SV=1
13	L0T864	0.76	33.1	158	0.038	0.095	FPG2_MYCTU Uncharacterized formamidopyrimidine-DNA glycosylase-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fpg2 PE=1 SV=1
14	P32634	2.1	33.1	1753	0.077	0.017	PMD1_YEAST Negative regulator of sporulation PMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMD1 PE=1 SV=1
15	Q8NF37	2.1	33.1	534	0.046	0.034	PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2
16	Q3TFD2	2.7	32.7	534	0.046	0.034	PCAT1_MOUSE Lysophosphatidylcholine acyltransferase 1 OS=Mus musculus OX=10090 GN=Lpcat1 PE=1 SV=1
17	Q1HAQ0	2.8	32.7	534	0.046	0.034	PCAT1_RAT Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Lpcat1 PE=1 SV=2
18	Q9JK81	3.0	32.3	380	0.077	0.079	MYG1_MOUSE MYG1 exonuclease OS=Mus musculus OX=10090 GN=Myg1 PE=1 SV=1
19	Q64511	3.3	32.7	1612	0.062	0.015	TOP2B_MOUSE DNA topoisomerase 2-beta OS=Mus musculus OX=10090 GN=Top2b PE=1 SV=2
20	A0A8I5Y7L4	6.2	31.6	1614	0.064	0.015	A0A8I5Y7L4_RAT DNA topoisomerase 2 OS=Rattus norvegicus OX=10116 GN=Top2b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01149 Fapy_DNA_glyco	1.7e-11	56.2	Formamidopyrimidine-DNA glycosylase N-terminal domain
2	PF06831 H2TH	0.0001	33.5	Formamidopyrimidine-DNA glycosylase H2TH domain
3	PF09292 Neil1-DNA_bind	2.6e-21	86.4	Endonuclease VIII-like 1, DNA bind

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262887	0.990	DNA repair protein XRCC1
2	9606.ENSP00000305480	0.985	Flap endonuclease 1
3	9606.ENSP00000306561	0.982	N-glycosylase/DNA lyase
4	9606.ENSP00000265421	0.966	DNA polymerase beta
5	9606.ENSP00000284503	0.958	Endonuclease 8-like 2
6	9606.ENSP00000367787	0.943	DNA ligase 3
7	9606.ENSP00000219066	0.911	Endonuclease III-like protein 1
8	9606.ENSP00000323511	0.903	Bifunctional polynucleotide phosphatase/kinase
9	9606.ENSP00000264596	0.896	Endonuclease 8-like 3
10	9606.ENSP00000298139	0.885	Werner syndrome ATP-dependent helicase
11	9606.ENSP00000219431	0.873	DNA-3-methyladenine glycosylase
12	9606.ENSP00000216714	0.836	DNA-(apurinic or apyrimidinic site) lyase
13	9606.ENSP00000361170	0.799	Adenine DNA glycosylase
14	9606.ENSP00000258774	0.793	Checkpoint protein HUS1
15	9606.ENSP00000424191	0.773	Single-strand selective monofunctional uracil DNA glycosylase
16	9606.ENSP00000376611	0.759	G/T mismatch-specific thymine DNA glycosylase
17	9606.ENSP00000263274	0.723	DNA ligase 1
18	9606.ENSP00000242576	0.717	Uracil-DNA glycosylase
19	9606.ENSP00000311360	0.712	Cell cycle checkpoint control protein RAD9A
20	9606.ENSP00000337353	0.687	Tyrosyl-DNA phosphodiesterase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003906	1.000	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0019104	1.000	DNA N-glycosylase activity
GO:0005488	0.811	binding
GO:0005515	0.526	protein binding
GO:1901363	0.491	heterocyclic compound binding
GO:0097159	0.491	organic cyclic compound binding
GO:0003676	0.477	nucleic acid binding
GO:0003677	0.471	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006281	0.988	DNA repair
GO:0050789	0.982	regulation of biological process
GO:0006284	0.979	base-excision repair
GO:0019222	0.967	regulation of metabolic process
GO:1901564	0.960	organonitrogen compound metabolic process
GO:0043412	0.944	macromolecule modification
GO:0050794	0.934	regulation of cellular process
GO:0046700	0.934	heterocycle catabolic process
GO:0044270	0.934	cellular nitrogen compound catabolic process
GO:1901361	0.933	organic cyclic compound catabolic process
GO:0009262	0.926	deoxyribonucleotide metabolic process
GO:0019692	0.924	deoxyribose phosphate metabolic process
GO:0072527	0.923	pyrimidine-containing compound metabolic process
GO:0034655	0.901	nucleobase-containing compound catabolic process
GO:0060255	0.898	regulation of macromolecule metabolic process
GO:0051171	0.870	regulation of nitrogen compound metabolic process
GO:0080090	0.865	regulation of primary metabolic process
GO:0031323	0.853	regulation of cellular metabolic process
GO:0009166	0.846	nucleotide catabolic process
GO:0048523	0.844	negative regulation of cellular process
GO:0019219	0.839	regulation of nucleobase-containing compound metabolic process
GO:0009394	0.835	2'-deoxyribonucleotide metabolic process
GO:0006220	0.833	pyrimidine nucleotide metabolic process
GO:0009219	0.824	pyrimidine deoxyribonucleotide metabolic process
GO:0006304	0.805	DNA modification
GO:0072529	0.792	pyrimidine-containing compound catabolic process
GO:1901136	0.750	carbohydrate derivative catabolic process
GO:0051172	0.626	negative regulation of nitrogen compound metabolic process
GO:0031324	0.572	negative regulation of cellular metabolic process
GO:0045934	0.345	negative regulation of nucleobase-containing compound metabolic process
GO:0065009	0.336	regulation of molecular function
GO:0050790	0.308	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.955	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]