StarFunc result for job id Q96FJ0

User Input

>input (436 residues)
MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FJ0	1.000	1.000	5.384E-78	436	1.000	1.000	Q96FJ0.pdb.gz	STALP_HUMAN AMSH-like protease OS=Homo sapiens OX=9606 GN=STAMBPL1 PE=1 SV=2
2	AFDB:A0A140VK54	0.821	0.844	5.310E-52	424	0.546	0.561	A0A140VK54.pdb.gz	A0A140VK54_HUMAN Testicular secretory protein Li 54 OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:Q9CQ26	0.823	0.845	4.946E-51	424	0.518	0.533	Q9CQ26.pdb.gz	STABP_MOUSE STAM-binding protein OS=Mus musculus OX=10090 GN=Stambp PE=1 SV=1
4	AFDB:Q9P371	0.614	0.616	1.052E-30	435	0.321	0.322	Q9P371.pdb.gz	SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sst2 PE=1 SV=1
5	AFDB:Q5PNU3	0.561	0.487	1.199E-27	507	0.300	0.258	Q5PNU3.pdb.gz	AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana OX=3702 GN=AMSH3 PE=1 SV=2
6	PDB:6qw65A	0.306	0.066	6.232E-8	2212	0.085	0.017	6qw65A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
7	PDB:5z56A	0.303	0.066	7.835E-8	2232	0.087	0.017	5z56A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
8	PDB:5z57A	0.303	0.074	7.835E-8	1978	0.087	0.019	5z57A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
9	PDB:6iczA	0.303	0.065	7.835E-8	2253	0.087	0.017	6iczA.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
10	PDB:5gm6A	0.314	0.069	2.324E-7	2200	0.087	0.017	5gm6A.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
11	PDB:5l4kV	0.276	0.394	3.673E-7	293	0.092	0.137	5l4kV.pdb.gz
12	PDB:6oa9G	0.259	0.243	9.175E-7	468	0.067	0.062	6oa9G.pdb.gz	Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.
13	PDB:5lqwA	0.309	0.071	2.044E-6	2130	0.092	0.019	5lqwA.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
14	PDB:5nrlA	0.306	0.067	2.721E-6	2216	0.092	0.018	5nrlA.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:3jckG	0.242	0.389	2.882E-6	257	0.069	0.117	3jckG.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
16	AFDB:Q9DCH4	0.238	0.282	1.571E-5	361	0.080	0.097	Q9DCH4.pdb.gz	EIF3F_MOUSE Eukaryotic translation initiation factor 3 subunit F OS=Mus musculus OX=10090 GN=Eif3f PE=1 SV=2
17	AFDB:Q9VCY3	0.218	0.268	3.121E-5	341	0.069	0.088	Q9VCY3.pdb.gz	CSN6_DROME COP9 signalosome complex subunit 6 OS=Drosophila melanogaster OX=7227 GN=CSN6 PE=1 SV=1
18	AFDB:Q95PZ0	0.236	0.241	3.404E-3	426	0.039	0.040	Q95PZ0.pdb.gz	CSN6_CAEEL COP9 signalosome complex subunit 6 OS=Caenorhabditis elegans OX=6239 GN=csn-6 PE=1 SV=1
19	AFDB:P89105	0.174	0.085	3.556E-2	1077	0.085	0.034	P89105.pdb.gz	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3
20	AFDB:A8MX29	0.180	0.221	3.987E-2	333	0.073	0.096	A8MX29.pdb.gz	A8MX29_HUMAN Kinesin light chain OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96FJ0	0.0	908	436	1.000	1.000	STALP_HUMAN AMSH-like protease OS=Homo sapiens OX=9606 GN=STAMBPL1 PE=1 SV=2
2	A0A140VK54	1.14e-165	474	424	0.550	0.566	A0A140VK54_HUMAN Testicular secretory protein Li 54 OS=Homo sapiens OX=9606 PE=2 SV=1
3	O95630	1.14e-165	474	424	0.550	0.566	STABP_HUMAN STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1
4	Q9CQ26	1.61e-158	456	424	0.523	0.538	STABP_MOUSE STAM-binding protein OS=Mus musculus OX=10090 GN=Stambp PE=1 SV=1
5	C9JK83	1.58e-103	312	318	0.388	0.531	C9JK83_HUMAN STAM-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1
6	Q9P371	4.32e-56	193	435	0.328	0.329	SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sst2 PE=1 SV=1
7	Q5PNU3	1.07e-46	170	507	0.197	0.170	AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana OX=3702 GN=AMSH3 PE=1 SV=2
8	P43588	8.67e-08	55.8	306	0.080	0.114	RPN11_YEAST Ubiquitin carboxyl-terminal hydrolase RPN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN11 PE=1 SV=1
9	P41878	2.86e-07	54.3	308	0.099	0.140	RPN11_SCHPO 26S proteasome regulatory subunit rpn11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn11 PE=1 SV=2
10	Q86IJ1	1.73e-06	52.0	306	0.073	0.105	PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum OX=44689 GN=psmD14 PE=3 SV=1
11	A0A8I6AHX8	4.26e-06	50.4	285	0.076	0.116	A0A8I6AHX8_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
12	A0A0G2JZJ1	4.37e-06	50.4	306	0.076	0.108	A0A0G2JZJ1_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
13	O00487	4.37e-06	50.8	310	0.076	0.106	PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1
14	O35593	4.37e-06	50.8	310	0.076	0.106	PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus OX=10090 GN=Psmd14 PE=1 SV=2
15	Q17QP9	4.37e-06	50.8	310	0.076	0.106	Q17QP9_BOVIN Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Bos taurus OX=9913 GN=PSMD14 PE=1 SV=1
16	Q4V8E2	4.37e-06	50.8	310	0.076	0.106	Q4V8E2_RAT Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
17	A3KNN5	5.33e-06	50.4	310	0.076	0.106	A3KNN5_DANRE 26S proteasome non-ATPase regulatory subunit 14 OS=Danio rerio OX=7955 GN=zgc:162272 PE=1 SV=1
18	Q9V3H2	7.90e-06	49.7	308	0.076	0.107	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
19	Q9LT08	8.85e-05	46.6	308	0.064	0.091	PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN11 PE=1 SV=1
20	O76577	1.66e-04	45.8	312	0.060	0.083	PSDE_CAEEL 26S proteasome non-ATPase regulatory subunit 14 OS=Caenorhabditis elegans OX=6239 GN=rpn-11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17213 Hydin_ADK	2.7e+02	13.0	Hydin Adenylate kinase-like domain
2	PF01398 JAB	2.9e-15	67.7	JAB1/Mov34/MPN/PAD-1 ubiquitin protease
3	PF14464 Prok-JAB	0.00054	31.2	Prokaryotic homologs of the JAB domain
4	PF08969 USP8_dimer	2.4e-17	74.5	USP8 dimerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360994

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441543	0.996	Polyubiquitin-C
2	9606.ENSP00000272317	0.987	Ubiquitin-40S ribosomal protein S27a
3	9606.ENSP00000304697	0.987	Polyubiquitin-B
4	9606.ENSP00000388107	0.987	Ubiquitin-60S ribosomal protein L40
5	9606.ENSP00000262646	0.880	Ras-related protein Rab-2A
6	9606.ENSP00000479606	0.836	Clathrin heavy chain 1
7	9606.ENSP00000262160	0.724	Mothers against decapentaplegic homolog 2
8	9606.ENSP00000314499	0.721	Cyclin-G-associated kinase
9	9606.ENSP00000316176	0.716	Ubiquitin-conjugating enzyme E2 N
10	9606.ENSP00000350512	0.715	COP9 signalosome complex subunit 5
11	9606.ENSP00000379721	0.707	Ubiquitin carboxyl-terminal hydrolase 8
12	9606.ENSP00000358474	0.702	Lys-63-specific deubiquitinase BRCC36
13	9606.ENSP00000418734	0.699	Histone H2A deubiquitinase MYSM1
14	9606.ENSP00000276569	0.695	Armadillo repeat containing 1
15	9606.ENSP00000429824	0.689	Clathrin interactor 1
16	9606.ENSP00000360998	0.680	Ankyrin repeat domain-containing protein 22
17	9606.ENSP00000478877	0.671	Proteasomal ubiquitin receptor ADRM1
18	9606.ENSP00000313811	0.670	Ubiquitin carboxyl-terminal hydrolase 20
19	9606.ENSP00000377633	0.670	STAM-binding protein
20	9606.ENSP00000444357	0.670	Ubiquitin thioesterase OTUB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061578	1.000	K63-linked deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0070646	0.993	protein modification by small protein removal
GO:0016579	0.975	protein deubiquitination
GO:0009987	0.797	cellular process
GO:0050789	0.763	regulation of biological process
GO:0050794	0.641	regulation of cellular process
GO:0050896	0.362	response to stimulus
GO:0048518	0.335	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0031981	0.949	nuclear lumen
GO:0005654	0.931	nucleoplasm
GO:0005886	0.776	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]