StarFunc result for job id Q96FJ2

User Input

>input (89 residues)
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1RM30	0.986	0.699	4.786E-17	126	0.989	0.698	Q1RM30.pdb.gz
2	AFDB:Q39580	0.983	0.961	2.602E-16	91	0.899	0.879	Q39580.pdb.gz	DYL1_CHLRE Dynein 8 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
3	AFDB:Q4FKD8	0.976	0.965	1.090E-15	90	0.854	0.844	Q4FKD8.pdb.gz	Q4FKD8_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.0845 PE=3 SV=1
4	PDB:1re6A	0.897	0.853	5.887E-15	94	1.000	0.947	1re6A.pdb.gz
5	AFDB:Q9UR05	0.939	0.983	1.295E-14	85	0.730	0.765	Q9UR05.pdb.gz	DYL1_SCHPO Dynein light chain 1, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dlc2 PE=3 SV=1
6	AFDB:O94111	0.949	0.898	2.326E-14	94	0.685	0.649	O94111.pdb.gz	DYL1_EMENI Dynein light chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudG PE=3 SV=1
7	AFDB:Q387L9	0.970	0.960	8.557E-14	90	0.618	0.611	Q387L9.pdb.gz	Q387L9_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0815 PE=3 SV=1
8	AFDB:Q84VW0	0.950	0.689	1.350E-13	123	0.685	0.496	Q84VW0.pdb.gz	Q84VW0_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=DL4005W PE=1 SV=1
9	PDB:4ds1A	0.937	0.969	3.054E-12	86	0.449	0.465	4ds1A.pdb.gz	Structure of a yeast Dyn2-Nup159 complex and molecular basis for dynein light chain-nuclear pore interaction.
10	AFDB:Q02647	0.951	0.920	9.301E-12	92	0.483	0.467	Q02647.pdb.gz	DYL1_YEAST Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN2 PE=1 SV=1
11	AFDB:Q57Z05	0.917	0.907	3.651E-11	90	0.449	0.444	Q57Z05.pdb.gz	Q57Z05_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.790 PE=3 SV=1
12	AFDB:Q4W5W8	0.922	0.269	1.433E-10	313	0.472	0.134	Q4W5W8.pdb.gz	Q4W5W8_VICFA Dynein light chain OS=Vicia faba OX=3906 GN=vfPIP PE=1 SV=1
13	PDB:1xdxA	0.485	0.406	5.636E-2	114	0.090	0.070	1xdxA.pdb.gz
14	PDB:3fm7B	0.393	0.345	1.462	104	0.090	0.077	3fm7B.pdb.gz	Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
15	PDB:7eu0H	0.181	0.132	1.897	126	0.090	0.063	7eu0H.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
16	PDB:1q3bA	0.231	0.101	2.462	259	0.045	0.015	1q3bA.pdb.gz	Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
17	PDB:7ohaM	0.229	0.194	2.628	107	0.169	0.140	7ohaM.pdb.gz	Structures and implications of TBP-nucleosome complexes.
18	PDB:7v6cB	0.288	0.119	2.628	260	0.101	0.035	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
19	PDB:5jpwA	0.416	0.290	2.804	143	0.090	0.056	5jpwA.pdb.gz
20	PDB:2waqG	0.173	0.139	3.194	113	0.056	0.044	2waqG.pdb.gz	Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q78P75	1.07e-63	188	89	1.000	1.000	DYL2_RAT Dynein light chain 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll2 PE=1 SV=1
2	Q96FJ2	1.07e-63	188	89	1.000	1.000	DYL2_HUMAN Dynein light chain 2, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL2 PE=1 SV=1
3	Q9D0M5	1.07e-63	188	89	1.000	1.000	DYL2_MOUSE Dynein light chain 2, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll2 PE=1 SV=1
4	Q7SZP6	2.32e-63	189	115	0.989	0.765	Q7SZP6_DANRE Dynein light chain (Fragment) OS=Danio rerio OX=7955 GN=dnl2 PE=2 SV=2
5	Q5BL99	3.01e-63	187	89	0.989	0.989	Q5BL99_DANRE Dynein light chain OS=Danio rerio OX=7955 GN=dynll2b PE=1 SV=1
6	Q24117	2.15e-62	185	89	0.966	0.966	DYL1_DROME Dynein light chain 1, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ctp PE=1 SV=1
7	O96860	7.68e-62	184	89	0.955	0.955	DYL2_DROME Dynein light chain 2, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Cdlc2 PE=1 SV=1
8	Q22799	1.87e-61	183	89	0.955	0.955	DYL1_CAEEL Dynein light chain 1, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=dlc-1 PE=1 SV=1
9	P61285	4.62e-60	179	89	0.933	0.933	DYL1_BOVIN Dynein light chain 1, cytoplasmic OS=Bos taurus OX=9913 GN=DYNLL1 PE=1 SV=1
10	P63167	4.62e-60	179	89	0.933	0.933	DYL1_HUMAN Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1
11	P63168	4.62e-60	179	89	0.933	0.933	DYL1_MOUSE Dynein light chain 1, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll1 PE=1 SV=1
12	P63170	4.62e-60	179	89	0.933	0.933	DYL1_RAT Dynein light chain 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll1 PE=1 SV=1
13	Q39580	1.19e-57	173	91	0.899	0.879	DYL1_CHLRE Dynein 8 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 PE=1 SV=1
14	Q4FKD8	3.82e-53	162	90	0.831	0.822	Q4FKD8_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.0845 PE=3 SV=1
15	Q9UR05	1.48e-47	147	85	0.730	0.765	DYL1_SCHPO Dynein light chain 1, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dlc2 PE=3 SV=1
16	O94111	5.14e-43	136	94	0.685	0.649	DYL1_EMENI Dynein light chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudG PE=3 SV=1
17	Q84VW0	9.10e-43	137	123	0.685	0.496	Q84VW0_ARATH Dynein light chain OS=Arabidopsis thaliana OX=3702 GN=DL4005W PE=1 SV=1
18	Q387L9	2.48e-40	129	90	0.618	0.611	Q387L9_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0815 PE=3 SV=1
19	Q02647	1.95e-29	102	92	0.483	0.467	DYL1_YEAST Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DYN2 PE=1 SV=1
20	Q57Z05	5.49e-27	96.3	90	0.438	0.433	Q57Z05_TRYB2 Dynein light chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.790 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20420 DUF6702	1.5e+02	13.8	Domain of unknown function (DUF6702)
2	PF01221 Dynein_light	2.1e-39	145.1	Dynein light chain type 1
3	PF06457 Ectatomin	5.1e+02	12.0	Ectatomin
4	PF01798 Nop	3.2e+02	12.1	snoRNA binding domain, fibrillarin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 8479.XP_005298897.1

Rank	PPI partner	STRING score	Description
1	8479.XP_008170263.1	0.993	Dynein light chain 1, cytoplasmic
2	8479.XP_005290511.1	0.967	Cytoplasmic dynein 1 intermediate chain 2 isoform X1
3	8479.XP_005299914.1	0.967	Dynein cytoplasmic 1 intermediate chain 1
4	8479.XP_008172657.1	0.965	Dynactin subunit 1
5	8479.XP_008164697.1	0.964	Dynactin subunit 4
6	8479.XP_005291595.1	0.963	Dynein light chain Tctex-type 1
7	8479.XP_005296164.1	0.960	Dynein cytoplasmic 2 light intermediate chain 1
8	8479.XP_008176872.1	0.960	Dynein cytoplasmic 2 heavy chain 1
9	8479.XP_005305125.1	0.935	Myosin VA
10	8479.XP_005294713.1	0.929	Dynein light chain Tctex-type 3
11	8479.XP_005310934.1	0.929	Dynein cytoplasmic 1 light intermediate chain 2
12	8479.XP_008167454.1	0.926	WD repeat domain 34
13	8479.XP_005278757.1	0.921	Cytoplasmic dynein 1 light intermediate chain 1
14	8479.XP_005292383.1	0.915	Dynein light chain roadblock-type 2 isoform X1
15	8479.XP_008176321.1	0.915	Dynein light chain roadblock-type 1
16	8479.XP_008165271.1	0.909	BCL2 like 11
17	8479.XP_005298953.1	0.908	Platelet activating factor acetylhydrolase 1b regulatory subunit 1
18	8479.XP_008173467.1	0.897	Myosin light polypeptide 6
19	8479.XP_005311142.1	0.889	Myosin light chain 6B
20	8479.XP_008172208.1	0.889	Striatin-4 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0016043	0.954	cellular component organization
GO:0065007	0.944	biological regulation
GO:0006996	0.853	organelle organization
GO:0007017	0.763	microtubule-based process
GO:0050789	0.681	regulation of biological process
GO:0051179	0.668	localization
GO:0051649	0.576	establishment of localization in cell
GO:0032502	0.570	developmental process
GO:0050794	0.553	regulation of cellular process
GO:0044085	0.533	cellular component biogenesis
GO:0022607	0.522	cellular component assembly
GO:0007018	0.510	microtubule-based movement
GO:0048856	0.396	anatomical structure development
GO:0051640	0.351	organelle localization
GO:0046907	0.333	intracellular transport
GO:0051656	0.308	establishment of organelle localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	0.997	microtubule cytoskeleton
GO:1902494	0.990	catalytic complex
GO:0005875	0.990	microtubule associated complex
GO:0030286	0.983	dynein complex
GO:0005737	0.961	cytoplasm
GO:0005868	0.784	cytoplasmic dynein complex
GO:0005634	0.777	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]