StarFunc result for job id Q96FL8

User Input

>input (570 residues)
MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSA
LVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLN
QGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKL
HQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDH
VGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNV
PRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRK
QLVLRRGLLLLGVFLILLVGILVRFYVRIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FL8	1.000	1.000	6.491E-70	570	1.000	1.000	Q96FL8.pdb.gz	S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens OX=9606 GN=SLC47A1 PE=1 SV=1
2	AFDB:A7KAU2	0.903	0.906	7.118E-57	568	0.765	0.768	A7KAU2.pdb.gz	S47A1_RABIT Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A1 PE=2 SV=1
3	AFDB:Q8K0H1	0.893	0.898	1.063E-56	567	0.777	0.781	Q8K0H1.pdb.gz	S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus OX=10090 GN=Slc47a1 PE=1 SV=2
4	AFDB:Q3V050	0.840	0.835	9.708E-45	573	0.535	0.532	Q3V050.pdb.gz	S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus OX=10090 GN=Slc47a2 PE=1 SV=1
5	AFDB:A7KAU3	0.844	0.800	6.060E-41	601	0.504	0.478	A7KAU3.pdb.gz	S47A2_RABIT Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A2 PE=1 SV=1
6	AFDB:Q86VL8	0.819	0.777	2.186E-40	602	0.488	0.462	Q86VL8.pdb.gz	S47A2_HUMAN Multidrug and toxin extrusion protein 2 OS=Homo sapiens OX=9606 GN=SLC47A2 PE=1 SV=1
7	AFDB:Q9USK3	0.781	0.825	5.661E-28	539	0.270	0.286	Q9USK3.pdb.gz	YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4B3.13 PE=3 SV=1
8	AFDB:Q9FHB6	0.766	0.897	4.128E-26	486	0.270	0.317	Q9FHB6.pdb.gz	DTX16_ARATH Protein DETOXIFICATION 16 OS=Arabidopsis thaliana OX=3702 GN=DTX16 PE=2 SV=1
9	AFDB:Q9C994	0.785	0.920	5.466E-26	485	0.249	0.293	Q9C994.pdb.gz	DTX14_ARATH Protein DETOXIFICATION 14 OS=Arabidopsis thaliana OX=3702 GN=DTX14 PE=1 SV=1
10	AFDB:Q9SZE2	0.768	0.822	1.038E-25	532	0.254	0.273	Q9SZE2.pdb.gz	DTX51_ARATH Protein DETOXIFICATION 51 OS=Arabidopsis thaliana OX=3702 GN=DTX51 PE=2 SV=1
11	PDB:5y50A	0.755	0.955	8.190E-24	448	0.242	0.308	5y50A.pdb.gz
12	PDB:6cc4A	0.416	0.395	2.032E-4	608	0.112	0.105	6cc4A.pdb.gz
13	PDB:6s4mA	0.160	0.188	3.792E-3	426	0.104	0.138	6s4mA.pdb.gz
14	PDB:6wbvA	0.160	0.188	8.123E-3	429	0.107	0.142	6wbvA.pdb.gz	Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms.
15	PDB:5oxpA	0.146	0.162	1.314E-2	462	0.114	0.141	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
16	PDB:7sptA	0.173	0.196	1.606E-2	470	0.135	0.164	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
17	PDB:7p54A	0.112	0.143	3.726E-2	397	0.109	0.156	7p54A.pdb.gz
18	PDB:6fmrA	0.188	0.204	4.037E-2	475	0.104	0.124	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
19	PDB:6gs1A	0.182	0.203	4.374E-2	472	0.081	0.097	6gs1A.pdb.gz
20	PDB:3o7qA	0.223	0.263	4.553E-2	414	0.109	0.150	3o7qA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7KAU2	0.0	788	568	0.770	0.773	S47A1_RABIT Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A1 PE=2 SV=1
2	Q3V050	0.0	600	573	0.535	0.532	S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus OX=10090 GN=Slc47a2 PE=1 SV=1
3	Q5I0E9	0.0	839	566	0.784	0.790	S47A1_RAT Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus OX=10116 GN=Slc47a1 PE=1 SV=1
4	Q8K0H1	0.0	862	567	0.781	0.785	S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus OX=10090 GN=Slc47a1 PE=1 SV=2
5	Q96FL8	0.0	1149	570	1.000	1.000	S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens OX=9606 GN=SLC47A1 PE=1 SV=1
6	A7KAU3	1.04e-173	506	601	0.507	0.481	S47A2_RABIT Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A2 PE=1 SV=1
7	Q86VL8	3.29e-170	498	602	0.491	0.465	S47A2_HUMAN Multidrug and toxin extrusion protein 2 OS=Homo sapiens OX=9606 GN=SLC47A2 PE=1 SV=1
8	Q9USK3	8.62e-76	252	539	0.263	0.278	YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4B3.13 PE=3 SV=1
9	Q9FHB6	1.11e-74	247	486	0.284	0.333	DTX16_ARATH Protein DETOXIFICATION 16 OS=Arabidopsis thaliana OX=3702 GN=DTX16 PE=2 SV=1
10	Q9SZE2	6.99e-73	244	532	0.258	0.276	DTX51_ARATH Protein DETOXIFICATION 51 OS=Arabidopsis thaliana OX=3702 GN=DTX51 PE=2 SV=1
11	Q9SIA5	2.17e-72	241	476	0.253	0.303	DTX1_ARATH Protein DETOXIFICATION 1 OS=Arabidopsis thaliana OX=3702 GN=DTX1 PE=2 SV=1
12	Q4PSF4	1.71e-71	239	508	0.261	0.293	DTX52_ARATH Protein DETOXIFICATION 52 OS=Arabidopsis thaliana OX=3702 GN=DTX52 PE=2 SV=1
13	Q9C994	3.57e-67	228	485	0.251	0.295	DTX14_ARATH Protein DETOXIFICATION 14 OS=Arabidopsis thaliana OX=3702 GN=DTX14 PE=1 SV=1
14	Q9SLV0	3.84e-67	229	532	0.256	0.274	DTX48_ARATH Protein DETOXIFICATION 48 OS=Arabidopsis thaliana OX=3702 GN=DTX48 PE=2 SV=1
15	Q9FJ87	5.23e-63	217	505	0.239	0.269	DTX50_ARATH Protein DETOXIFICATION 50 OS=Arabidopsis thaliana OX=3702 GN=DTX50 PE=2 SV=1
16	Q8L731	1.84e-61	212	481	0.244	0.289	DTX12_ARATH Protein DETOXIFICATION 12 OS=Arabidopsis thaliana OX=3702 GN=DTX12 PE=2 SV=1
17	Q9LVD9	2.19e-61	213	506	0.244	0.275	DTX40_ARATH Protein DETOXIFICATION 40 OS=Arabidopsis thaliana OX=3702 GN=DTX40 PE=1 SV=1
18	Q9UT92	4.60e-60	210	533	0.230	0.246	YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC323.07c PE=1 SV=1
19	Q10085	2.71e-59	206	455	0.233	0.292	YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11D3.06 PE=3 SV=1
20	Q9SX83	4.08e-57	201	484	0.254	0.300	DTX33_ARATH Protein DETOXIFICATION 33 OS=Arabidopsis thaliana OX=3702 GN=DTX33 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01554 MatE	5.2e-59	210.0	MatE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355930	0.903	Solute carrier family 22 member 1
2	9606.ENSP00000355920	0.890	Solute carrier family 22 member 2
3	9606.ENSP00000357915	0.780	Solute carrier family 22 member 16
4	9606.ENSP00000337335	0.768	Solute carrier family 22 member 8
5	9606.ENSP00000261196	0.755	Solute carrier organic anion transporter family member 1B3
6	9606.ENSP00000441269	0.755	Solute carrier organic anion transporter family member
7	9606.ENSP00000380081	0.745	Equilibrative nucleoside transporter 4
8	9606.ENSP00000362285	0.741	Equilibrative nucleoside transporter 3
9	9606.ENSP00000256958	0.736	Solute carrier organic anion transporter family member 1B1
10	9606.ENSP00000200652	0.734	Solute carrier family 22 member 4
11	9606.ENSP00000275300	0.720	Solute carrier family 22 member 3
12	9606.ENSP00000245407	0.707	Solute carrier family 22 member 5
13	9606.ENSP00000237612	0.703	ATP-binding cassette sub-family G member 2
14	9606.ENSP00000289575	0.702	Solute carrier organic anion transporter family member 2B1
15	9606.ENSP00000367102	0.701	Solute carrier family 22 member 6
16	9606.ENSP00000366084	0.698	Multidrug resistance-associated protein 4
17	9606.ENSP00000399136	0.696	Sodium- and chloride-dependent betaine transporter
18	9606.ENSP00000305302	0.695	Sodium-dependent neutral amino acid transporter B(0)AT1
19	9606.ENSP00000361666	0.695	Solute carrier family 22 member 7
20	9606.ENSP00000330199	0.686	Sodium-dependent neutral amino acid transporter SLC6A17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015101	1.000	organic cation transmembrane transporter activity
GO:0015297	1.000	antiporter activity
GO:0005515	0.971	protein binding
GO:0008514	0.949	organic anion transmembrane transporter activity
GO:0042910	0.907	xenobiotic transmembrane transporter activity
GO:0005342	0.818	organic acid transmembrane transporter activity
GO:0046943	0.782	carboxylic acid transmembrane transporter activity
GO:1901682	0.412	sulfur compound transmembrane transporter activity
GO:0061459	0.398	L-arginine transmembrane transporter activity
GO:0090482	0.390	vitamin transmembrane transporter activity
GO:0015203	0.388	polyamine transmembrane transporter activity
GO:1901474	0.385	azole transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071702	0.998	organic substance transport
GO:0009987	0.987	cellular process
GO:0055085	0.971	transmembrane transport
GO:0015695	0.954	organic cation transport
GO:0042908	0.835	xenobiotic transport
GO:0015711	0.540	organic anion transport
GO:0046942	0.482	carboxylic acid transport
GO:0050896	0.460	response to stimulus
GO:0071705	0.414	nitrogen compound transport
GO:0042221	0.402	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.786	plasma membrane region
GO:0043227	0.781	membrane-bounded organelle
GO:0045178	0.753	basal part of cell
GO:0009925	0.733	basal plasma membrane
GO:0016323	0.474	basolateral plasma membrane
GO:0016324	0.464	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32143	0.398	L-arginine(in) = L-arginine(out)

[back to server]