StarFunc result for job id Q96FS4

User Input

>input (1042 residues)
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEA
RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRT
QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQAS
GPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
FDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETA
GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQ
EPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRA
SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPK
GTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAES
ESAATRLLLASKQLGSPTADLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PSX8	0.697	0.698	0.000	1040	0.893	0.894	E9PSX8.pdb.gz	E9PSX8_RAT Signal-induced proliferation-associated 1 OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=1 SV=1
2	AFDB:Q96FS4	1.000	1.000	0.000	1042	1.000	1.000	Q96FS4.pdb.gz	SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1
3	AFDB:Q86RS9	0.307	0.423	6.342E-36	741	0.189	0.266	Q86RS9.pdb.gz	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
4	AFDB:H2L055	0.302	0.384	1.033E-35	811	0.200	0.256	H2L055.pdb.gz	H2L055_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53A10.2 PE=1 SV=1
5	AFDB:F1LV89	0.313	0.425	4.460E-35	753	0.201	0.278	F1LV89.pdb.gz	F1LV89_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=1 SV=3
6	AFDB:A2ALS5	0.313	0.480	9.524E-35	663	0.190	0.299	A2ALS5.pdb.gz	RPGP1_MOUSE Rap1 GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rap1gap PE=1 SV=2
7	AFDB:A0A1B0GV05	0.296	0.396	5.108E-34	771	0.194	0.262	A0A1B0GV05.pdb.gz	A0A1B0GV05_HUMAN RAP1 GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=RAP1GAP2 PE=1 SV=1
8	AFDB:Q54Q75	0.308	0.819	5.394E-32	366	0.125	0.355	Q54Q75.pdb.gz	Q54Q75_DICDI RapGAP/RanGAP domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284065 PE=4 SV=1
9	AFDB:Q54SS8	0.280	0.640	1.778E-27	418	0.092	0.230	Q54SS8.pdb.gz	RGAPB_DICDI RapA guanosine triphosphatase-activating protein B OS=Dictyostelium discoideum OX=44689 GN=rapgapB PE=2 SV=1
10	PDB:7dl2B	0.177	0.177	1.264E-11	1042	0.064	0.064	7dl2B.pdb.gz
11	PDB:7dl2A	0.174	0.163	5.764E-11	1127	0.058	0.053	7dl2A.pdb.gz
12	AFDB:D3ZWS0	0.104	0.073	1.601E-7	1663	0.173	0.108	D3ZWS0.pdb.gz	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
13	PDB:6r9tA	0.090	0.046	1.953E-3	2185	0.020	0.010	6r9tA.pdb.gz
14	PDB:7qqnC	0.073	0.174	3.544E-3	414	0.022	0.056	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7c3mA	0.077	0.123	4.647E-3	577	0.031	0.055	7c3mA.pdb.gz
16	PDB:7p70A	0.068	0.169	6.432E-3	407	0.017	0.044	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7p73A	0.067	0.162	8.902E-3	420	0.024	0.060	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7qqmA	0.066	0.161	1.530E-2	413	0.020	0.051	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:2xkxA	0.072	0.103	1.706E-2	721	0.025	0.036	2xkxA.pdb.gz
20	PDB:4gouA	0.081	0.154	1.801E-2	507	0.015	0.032	4gouA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PSX8	0.0	1849	1040	0.893	0.894	E9PSX8_RAT Signal-induced proliferation-associated 1 OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=1 SV=1
2	F5GYF8	0.0	584	1257	0.270	0.224	F5GYF8_HUMAN Signal induced proliferation associated 1 like 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=1
3	G3X9J0	0.0	638	1776	0.338	0.198	SI1L3_MOUSE Signal-induced proliferation-associated 1-like protein 3 OS=Mus musculus OX=10090 GN=Sipa1l3 PE=1 SV=1
4	O35412	0.0	667	1822	0.345	0.197	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
5	O43166	0.0	681	1804	0.341	0.197	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
6	O60292	0.0	634	1781	0.336	0.197	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
7	P46062	0.0	1825	1037	0.888	0.892	SIPA1_MOUSE Signal-induced proliferation-associated protein 1 OS=Mus musculus OX=10090 GN=Sipa1 PE=1 SV=2
8	Q6I7S1	0.0	1847	1040	0.892	0.893	Q6I7S1_RAT GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=2 SV=1
9	Q8C0T5	0.0	689	1782	0.345	0.201	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
10	Q96FS4	0.0	2096	1042	1.000	1.000	SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1
11	Q9P2F8	0.0	645	1722	0.331	0.200	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
12	G5EBY5	3.22e-133	429	995	0.256	0.268	G5EBY5_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sipa-1 PE=1 SV=1
13	H2L055	2.75e-66	241	811	0.130	0.166	H2L055_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53A10.2 PE=1 SV=1
14	Q9VM02	5.94e-66	241	850	0.131	0.161	Q9VM02_DROME Rap GTPase activating protein 1, isoform E OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
15	Q59DZ5	1.15e-65	240	876	0.131	0.156	Q59DZ5_DROME Rap GTPase activating protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
16	Q9VM00	1.34e-65	241	933	0.131	0.147	Q9VM00_DROME Rap GTPase activating protein 1, isoform D OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
17	O44090	1.42e-65	240	850	0.131	0.160	O44090_DROME GTPase activating protein for Rap1 OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=2 SV=1
18	A8DYW8	2.09e-65	241	959	0.131	0.143	A8DYW8_DROME Rap GTPase activating protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
19	Q86RS9	2.89e-65	237	741	0.129	0.181	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
20	Q5SVL6	6.25e-65	235	712	0.127	0.185	RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Rap1gap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	8.7	18.0	Autophagy protein 16 (ATG16)
2	PF10481 CENP-F_N	64	14.6	Cenp-F N-terminal domain
3	PF20492 ERM_helical	2.6e+02	13.1	Ezrin/radixin/moesin, alpha-helical domain
4	PF04728 LPP	6.9e+02	11.9	Lipoprotein leucine-zipper
5	PF12795 MscS_porin	7	17.7	Mechanosensitive ion channel porin domain
6	PF00595 PDZ	1.1e-05	37.0	PDZ domain
7	PF17820 PDZ_6	0.66	21.2	PDZ domain
8	PF09311 Rab5-bind	1e+02	13.7	Rabaptin-like protein
9	PF02145 Rap_GAP	2.3e-57	205.0	Rap/ran-GAP
10	PF06156 YabA	5.4e+02	12.6	Initiation control protein YabA
11	PF06005 ZapB	1.6e+02	14.2	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377771

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375960	0.949	Afadin
2	9606.ENSP00000358723	0.930	Ras-related protein Rap-1A
3	9606.ENSP00000250559	0.919	Ras-related protein Rap-1b
4	9606.ENSP00000339145	0.860	Ribosomal RNA processing protein 1 homolog B
5	9606.ENSP00000263377	0.851	Bromodomain-containing protein 4
6	9606.ENSP00000199280	0.822	Aquaporin-2
7	9606.ENSP00000272427	0.705	Exocyst complex component 6B
8	9606.ENSP00000216446	0.688	Pleckstrin-2
9	9606.ENSP00000264644	0.668	Rap guanine nucleotide exchange factor-like 1
10	9606.ENSP00000307853	0.626	Crossover junction endonuclease MUS81
11	9606.ENSP00000310275	0.591	Barrier-to-autointegration factor
12	9606.ENSP00000295225	0.589	Calsenilin
13	9606.ENSP00000245304	0.586	Ras-related protein Rap-2a
14	9606.ENSP00000378360	0.586	Triokinase/FMN cyclase
15	9606.ENSP00000358548	0.584	GTPase NRas
16	9606.ENSP00000337862	0.583	Putative transcription factor Ovo-like 1
17	9606.ENSP00000307479	0.570	Aryl hydrocarbon receptor nuclear translocator 2
18	9606.ENSP00000386881	0.568	Dysferlin
19	9606.ENSP00000435648	0.566	Glutamate receptor ionotropic, kainate 4
20	9606.ENSP00000304437	0.561	Protein very KIND

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.996	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0051716	0.968	cellular response to stimulus
GO:0007154	0.931	cell communication
GO:0023052	0.782	signaling
GO:0002250	0.559	adaptive immune response
GO:0007165	0.494	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0012505	0.991	endomembrane system
GO:0031982	0.948	vesicle
GO:0032991	0.947	protein-containing complex
GO:0016020	0.937	membrane
GO:0005634	0.812	nucleus
GO:0031410	0.686	cytoplasmic vesicle
GO:0070013	0.653	intracellular organelle lumen
GO:0065010	0.401	extracellular membrane-bounded organelle
GO:0031981	0.389	nuclear lumen
GO:0071944	0.378	cell periphery
GO:0005886	0.342	plasma membrane
GO:0030133	0.304	transport vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]