StarFunc result for job id Q96FV9

User Input

>input (657 residues)
MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQVPGSENEKKCTLDQAFRGILE
EEIINHSSCENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNV
ATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQ
FNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS
LQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVYFAK
FLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSV
YQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPE
DFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMV
ENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEI
KTGEDEDEEDNDALLKENESPDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIR
QIECDSEDMKMRAKQLLVAWQDQEGVHATPENLINALNKSGLSDLAESLTNDNETNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R3N6	0.548	0.548	2.855E-77	657	0.960	0.960	Q8R3N6.pdb.gz	THOC1_MOUSE THO complex subunit 1 OS=Mus musculus OX=10090 GN=Thoc1 PE=1 SV=1
2	AFDB:Q9VNI8	0.530	0.498	1.067E-37	701	0.379	0.355	Q9VNI8.pdb.gz	Q9VNI8_DROME Hpr1 OS=Drosophila melanogaster OX=7227 GN=Hpr1 PE=1 SV=1
3	AFDB:Q93VM9	0.415	0.449	7.417E-23	599	0.234	0.257	Q93VM9.pdb.gz	THOC1_ARATH THO complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=THO1 PE=1 SV=1
4	PDB:7apkI	0.302	0.598	5.334E-22	275	0.416	0.993	7apkI.pdb.gz
5	AFDB:Q9URT2	0.372	0.332	2.308E-15	752	0.202	0.177	Q9URT2.pdb.gz	YJU3_SCHPO Uncharacterized protein P25A2.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCP25A2.03 PE=1 SV=1
6	PDB:7v2wF	0.315	0.343	4.363E-3	593	0.122	0.135	7v2wF.pdb.gz
7	AFDB:D3ZZC5	0.131	0.269	5.030E-3	310	0.046	0.097	D3ZZC5.pdb.gz	D3ZZC5_RAT Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Rattus norvegicus OX=10116 GN=Tradd PE=4 SV=1
8	AFDB:O88843	0.129	0.405	5.697E-3	199	0.053	0.176	O88843.pdb.gz	CRADD_MOUSE Death domain-containing protein CRADD OS=Mus musculus OX=10090 GN=Cradd PE=1 SV=2
9	AFDB:Q15628	0.131	0.265	5.697E-3	312	0.050	0.106	Q15628.pdb.gz	TRADD_HUMAN Tumor necrosis factor receptor type 1-associated DEATH domain protein OS=Homo sapiens OX=9606 GN=TRADD PE=1 SV=2
10	AFDB:Q8CJ26	0.120	0.326	9.767E-3	228	0.064	0.184	Q8CJ26.pdb.gz	NRADD_MOUSE Death domain-containing membrane protein NRADD OS=Mus musculus OX=10090 GN=Nradd PE=1 SV=1
11	AFDB:O00220	0.122	0.169	1.153E-2	468	0.040	0.056	O00220.pdb.gz	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
12	AFDB:O14763	0.132	0.193	2.334E-2	440	0.044	0.066	O14763.pdb.gz	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
13	PDB:7qe7U	0.109	0.126	3.541E-1	540	0.100	0.122	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:3gniA	0.113	0.186	4.180E-1	335	0.067	0.131	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
15	PDB:7obqu	0.086	0.111	5.143E-1	441	0.056	0.084	7obqu.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
16	PDB:3wyfC	0.159	0.112	6.328E-1	1040	0.140	0.088	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
17	PDB:2gf5A	0.108	0.315	6.596E-1	191	0.035	0.120	2gf5A.pdb.gz
18	PDB:7kzmC	0.071	0.026	6.596E-1	3890	0.128	0.022	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
19	PDB:7pksh	0.088	0.071	7.786E-1	887	0.084	0.062	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
20	PDB:7dhgC	0.125	0.160	1.041	470	0.090	0.126	7dhgC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R3N6	0.0	1320	657	0.962	0.962	THOC1_MOUSE THO complex subunit 1 OS=Mus musculus OX=10090 GN=Thoc1 PE=1 SV=1
2	Q96FV9	0.0	1359	657	1.000	1.000	THOC1_HUMAN THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1
3	R4GMN4	0.0	543	272	0.402	0.971	R4GMN4_HUMAN THO complex subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1
4	Q9VNI8	5.44e-134	411	701	0.388	0.364	Q9VNI8_DROME Hpr1 OS=Drosophila melanogaster OX=7227 GN=Hpr1 PE=1 SV=1
5	Q93VM9	1.47e-66	231	599	0.212	0.232	THOC1_ARATH THO complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=THO1 PE=1 SV=1
6	Q9URT2	1.34e-31	133	752	0.178	0.156	YJU3_SCHPO Uncharacterized protein P25A2.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCP25A2.03 PE=1 SV=1
7	A0A5K1VW73	0.007	42.0	683	0.037	0.035	A0A5K1VW73_HUMAN Ankyrin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=2
8	A0A5F9ZH10	0.008	42.0	1005	0.037	0.024	A0A5F9ZH10_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZHV4	0.009	42.0	1001	0.037	0.024	A0A5F9ZHV4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A0A5F9ZI16	0.009	41.6	1055	0.037	0.023	A0A5F9ZI16_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	E9PCH6	0.009	41.6	1048	0.037	0.023	E9PCH6_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZH18	0.010	41.6	1109	0.037	0.022	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZH99	0.010	41.6	1060	0.037	0.023	A0A5F9ZH99_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	H0Y931	0.010	41.6	966	0.037	0.025	H0Y931_HUMAN Ankyrin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	H0Y8Y2	0.011	41.6	1062	0.037	0.023	H0Y8Y2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=2
16	A0A5F9ZH03	0.017	40.8	1785	0.037	0.013	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZHJ4	0.017	40.8	1818	0.037	0.013	A0A5F9ZHJ4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHL5	0.017	40.8	1872	0.037	0.013	A0A5F9ZHL5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHM6	0.017	40.8	1708	0.037	0.014	A0A5F9ZHM6_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHN0	0.017	40.8	1777	0.037	0.014	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	6.3e-15	66.4	Death domain
2	PF11957 efThoc1	1.8e-141	483.8	THO complex subunit 1 transcription elongation factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245838	0.999	THO complex subunit 2
2	9606.ENSP00000265097	0.999	THO complex subunit 3
3	9606.ENSP00000295899	0.999	THO complex subunit 7 homolog
4	9606.ENSP00000326531	0.999	THO complex subunit 6 homolog
5	9606.ENSP00000379475	0.999	Spliceosome RNA helicase DDX39B
6	9606.ENSP00000420306	0.999	THO complex subunit 5 homolog
7	9606.ENSP00000421592	0.998	THO complex subunit 4
8	9606.ENSP00000337632	0.991	SAP domain-containing ribonucleoprotein
9	9606.ENSP00000357679	0.988	Chromatin target of PRMT1 protein
10	9606.ENSP00000364289	0.946	Nuclear cap-binding protein subunit 1
11	9606.ENSP00000242776	0.944	ATP-dependent RNA helicase DDX39A
12	9606.ENSP00000436679	0.918	Nuclear RNA export factor 1
13	9606.ENSP00000397927	0.914	Polymerase delta-interacting protein 3
14	9606.ENSP00000241502	0.890	UAP56-interacting factor
15	9606.ENSP00000326806	0.888	Nuclear cap-binding protein subunit 2
16	9606.ENSP00000258962	0.884	Serine/arginine-rich splicing factor 1
17	9606.ENSP00000373657	0.881	Nuclear cap-binding protein subunit 3
18	9606.ENSP00000438527	0.877	Zinc finger CCCH domain-containing protein 11A
19	9606.ENSP00000269349	0.859	Eukaryotic initiation factor 4A-III
20	9606.ENSP00000254998	0.830	NTF2-related export protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0050789	0.988	regulation of biological process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0010467	0.988	gene expression
GO:0015931	0.985	nucleobase-containing compound transport
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0090304	0.977	nucleic acid metabolic process
GO:0006406	0.976	mRNA export from nucleus
GO:0051052	0.971	regulation of DNA metabolic process
GO:0048523	0.948	negative regulation of cellular process
GO:0010468	0.945	regulation of gene expression
GO:0051252	0.943	regulation of RNA metabolic process
GO:0048583	0.936	regulation of response to stimulus
GO:0010605	0.936	negative regulation of macromolecule metabolic process
GO:0048585	0.932	negative regulation of response to stimulus
GO:0000018	0.924	regulation of DNA recombination
GO:0048518	0.913	positive regulation of biological process
GO:0032784	0.904	regulation of DNA-templated transcription elongation
GO:0048522	0.890	positive regulation of cellular process
GO:0010604	0.855	positive regulation of macromolecule metabolic process
GO:0044260	0.817	cellular macromolecule metabolic process
GO:0080134	0.799	regulation of response to stress
GO:0051173	0.785	positive regulation of nitrogen compound metabolic process
GO:0051254	0.784	positive regulation of RNA metabolic process
GO:0010557	0.779	positive regulation of macromolecule biosynthetic process
GO:0031328	0.769	positive regulation of cellular biosynthetic process
GO:0016070	0.730	RNA metabolic process
GO:2001020	0.705	regulation of response to DNA damage stimulus
GO:1901987	0.682	regulation of cell cycle phase transition
GO:1901976	0.664	regulation of cell cycle checkpoint
GO:0006259	0.664	DNA metabolic process
GO:0045893	0.558	positive regulation of DNA-templated transcription
GO:0006396	0.422	RNA processing
GO:0032786	0.365	positive regulation of DNA-templated transcription, elongation
GO:2001021	0.362	negative regulation of response to DNA damage stimulus
GO:0050896	0.357	response to stimulus
GO:0031297	0.352	replication fork processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0140513	0.998	nuclear protein-containing complex
GO:0016604	0.997	nuclear body
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0016607	0.984	nuclear speck
GO:0000347	0.965	THO complex
GO:0005694	0.735	chromosome
GO:0098687	0.587	chromosomal region
GO:0005829	0.557	cytosol
GO:0000781	0.516	chromosome, telomeric region
GO:1902494	0.327	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]