StarFunc result for job id Q96FX2

User Input

>input (82 residues)
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYD
KDQFVCGETVPAPSANKELVKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6VUC1	0.881	0.881	2.969E-16	82	0.976	0.976	Q6VUC1.pdb.gz	DPH3_CRIGR Diphthamide biosynthesis protein 3 OS=Cricetulus griseus OX=10029 GN=DPH3 PE=3 SV=1
2	PDB:2jr7A	0.821	0.804	7.025E-15	84	0.976	0.952	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein
3	AFDB:Q21102	0.803	0.822	1.803E-12	80	0.598	0.613	Q21102.pdb.gz	DPH3_CAEEL Diphthamide biosynthesis protein 3 OS=Caenorhabditis elegans OX=6239 GN=dph-3 PE=3 SV=1
4	AFDB:Q9UT33	0.781	0.810	2.632E-11	79	0.488	0.506	Q9UT33.pdb.gz	DPH3_SCHPO Diphthamide biosynthesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph3 PE=3 SV=1
5	AFDB:Q3E840	0.733	0.733	1.569E-9	82	0.366	0.366	Q3E840.pdb.gz	DPH3_YEAST Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTI11 PE=1 SV=1
6	PDB:4d4oA	0.717	0.146	2.839E-8	414	0.366	0.072	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
7	AFDB:Q9UUG3	0.631	0.385	3.987E-6	139	0.268	0.158	Q9UUG3.pdb.gz	DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph4 PE=3 SV=1
8	AFDB:Q6P3W2	0.637	0.364	1.246E-5	149	0.171	0.094	Q6P3W2.pdb.gz	DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens OX=9606 GN=DNAJC24 PE=1 SV=2
9	PDB:2l6lA	0.514	0.299	9.435E-5	155	0.183	0.097	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
10	AFDB:P47138	0.552	0.283	2.029E-3	172	0.256	0.122	P47138.pdb.gz	DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JJJ3 PE=1 SV=1
11	AFDB:Q9ZQ34	0.313	0.089	3.091E-1	408	0.146	0.029	Q9ZQ34.pdb.gz	Y2433_ARATH Uncharacterized protein At2g24330 OS=Arabidopsis thaliana OX=3702 GN=At2g24330 PE=2 SV=1
12	AFDB:Q583D9	0.343	0.248	4.041E-1	121	0.110	0.074	Q583D9.pdb.gz	Q583D9_TRYB2 Zinc finger LSD1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.630 PE=4 SV=1
13	PDB:6ydhA	0.305	0.379	4.383E-1	62	0.098	0.129	6ydhA.pdb.gz
14	PDB:4btsA9	0.302	0.272	5.731E-1	93	0.110	0.097	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
15	AFDB:F4JR68	0.313	0.082	6.908E-1	443	0.146	0.027	F4JR68.pdb.gz	F4JR68_ARATH Integral membrane metal-binding family protein (DUF2296) OS=Arabidopsis thaliana OX=3702 GN=LNP22 PE=1 SV=1
16	PDB:4c2mI	0.291	0.204	8.012E-1	124	0.159	0.105	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
17	PDB:5n5yI	0.291	0.249	9.796E-1	99	0.146	0.121	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
18	PDB:1oacB	0.305	0.051	1.120	723	0.110	0.012	1oacB.pdb.gz	Crystal structure of a quinoenzyme: copper amine oxidase of Escherichia coli at 2 A resolution.
19	PDB:5svah	0.212	0.159	1.120	118	0.061	0.042	5svah.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
20	PDB:3a7lA	0.276	0.189	1.369	128	0.073	0.047	3a7lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96FX2	1.25e-55	167	82	1.000	1.000	DPH3_HUMAN Diphthamide biosynthesis protein 3 OS=Homo sapiens OX=9606 GN=DPH3 PE=1 SV=1
2	Q6VUC1	1.32e-54	165	82	0.976	0.976	DPH3_CRIGR Diphthamide biosynthesis protein 3 OS=Cricetulus griseus OX=10029 GN=DPH3 PE=3 SV=1
3	Q8K0W9	3.08e-54	164	82	0.963	0.963	DPH3_MOUSE Diphthamide biosynthesis protein 3 OS=Mus musculus OX=10090 GN=Dph3 PE=1 SV=1
4	Q9UT33	1.13e-24	89.7	79	0.463	0.481	DPH3_SCHPO Diphthamide biosynthesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph3 PE=3 SV=1
5	Q21102	2.33e-22	84.0	80	0.573	0.588	DPH3_CAEEL Diphthamide biosynthesis protein 3 OS=Caenorhabditis elegans OX=6239 GN=dph-3 PE=3 SV=1
6	Q3E840	1.85e-17	71.6	82	0.366	0.366	DPH3_YEAST Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTI11 PE=1 SV=1
7	D3YT20	2.22e-08	47.4	43	0.268	0.512	D3YT20_CAEEL DPH3 homolog OS=Caenorhabditis elegans OX=6239 GN=dph-3 PE=4 SV=1
8	Q9UUG3	2.42e-07	47.0	139	0.280	0.165	DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph4 PE=3 SV=1
9	Q6P3W2	3.06e-04	38.9	149	0.183	0.101	DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens OX=9606 GN=DNAJC24 PE=1 SV=2
10	P47138	0.22	31.2	172	0.232	0.110	DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JJJ3 PE=1 SV=1
11	Q5BG06	2.5	28.5	318	0.171	0.044	Q5BG06_EMENI NmrA-like domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00524 PE=4 SV=1
12	Q9FMF3	2.6	28.5	464	0.256	0.045	Q9FMF3_ARATH AT5G64360 protein OS=Arabidopsis thaliana OX=3702 GN=EIP9 PE=1 SV=1
13	G5EFD2	4.4	27.7	771	0.122	0.013	KSRA_CAEEL Kinase suppressor of Ras A OS=Caenorhabditis elegans OX=6239 GN=ksr-1 PE=1 SV=1
14	Q388Z0	5.2	27.3	166	0.195	0.096	Q388Z0_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1150 PE=3 SV=1
15	O33897	7.5	26.9	260	0.122	0.038	O33897_RHOMR Cellulase OS=Rhodothermus marinus OX=29549 GN=celA PE=1 SV=1
16	Q9M9H7	9.9	26.9	491	0.134	0.022	SOL1_ARATH Carboxypeptidase SOL1 OS=Arabidopsis thaliana OX=3702 GN=SOL1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05207 zf-CSL	3e-21	86.2	CSL zinc finger
2	PF02591 zf-RING_7	1.1e+02	14.4	C4-type zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000001284

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014534	0.952	Diphthamide biosynthesis 5
2	61853.ENSNLEP00000020854	0.941	Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.
3	61853.ENSNLEP00000016879	0.930	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
4	61853.ENSNLEP00000003630	0.874	annotation not available
5	61853.ENSNLEP00000023936	0.858	Elongator complex protein 3
6	61853.ENSNLEP00000007540	0.818	Elongator acetyltransferase complex subunit 2
7	61853.ENSNLEP00000021540	0.808	Secretion regulating guanine nucleotide exchange factor
8	61853.ENSNLEP00000021088	0.782	Elongator complex protein 1
9	61853.ENSNLEP00000021725	0.691	DnaJ (Hsp40) homolog, subfamily C, member 24
10	61853.ENSNLEP00000021729	0.691	Elongator acetyltransferase complex subunit 4
11	61853.ENSNLEP00000013623	0.685	Diphthine--ammonia ligase
12	61853.ENSNLEP00000006053	0.646	tRNA methyltransferase 11-2 homolog (S. cerevisiae)
13	61853.ENSNLEP00000013145	0.635	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
14	61853.ENSNLEP00000008799	0.604	AlkB homolog 8, tRNA methyltransferase
15	61853.ENSNLEP00000001278	0.598	Oxidoreductase NAD-binding domain containing 1
16	61853.ENSNLEP00000021314	0.582	Ubiquitin-related modifier 1
17	61853.ENSNLEP00000021420	0.574	Polypeptide N-acetylgalactosaminyltransferase 18
18	61853.ENSNLEP00000001324	0.559	Polypeptide N-acetylgalactosaminyltransferase 15
19	61853.ENSNLEP00000017451	0.559	DNA helicase
20	61853.ENSNLEP00000003059	0.553	Reactive intermediate imine deaminase A homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.906	catalytic activity
GO:0043167	0.558	ion binding
GO:0016740	0.545	transferase activity
GO:0046872	0.402	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0031323	0.966	regulation of cellular metabolic process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0080090	0.957	regulation of primary metabolic process
GO:0009058	0.956	biosynthetic process
GO:0034248	0.949	regulation of amide metabolic process
GO:2000112	0.948	regulation of cellular macromolecule biosynthetic process
GO:0043170	0.942	macromolecule metabolic process
GO:0044249	0.925	cellular biosynthetic process
GO:0051246	0.919	regulation of protein metabolic process
GO:0010468	0.907	regulation of gene expression
GO:0043412	0.902	macromolecule modification
GO:0006417	0.899	regulation of translation
GO:1901564	0.890	organonitrogen compound metabolic process
GO:0018193	0.856	peptidyl-amino acid modification
GO:0006448	0.843	regulation of translational elongation
GO:0017183	0.322	peptidyl-diphthamide biosynthetic process from peptidyl-histidine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.989	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.545	Transferases.

[back to server]