StarFunc result for job id Q96FX7

User Input

>input (289 residues)
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTC
GRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHA
IIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFL
DIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNV
RTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FX7	1.000	1.000	4.991E-66	289	1.000	1.000	Q96FX7.pdb.gz	TRM61_HUMAN tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1
2	PDB:5ccxA	0.950	0.969	1.649E-56	283	0.979	1.000	5ccxA.pdb.gz	Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
3	AFDB:A0A178UJ48	0.898	0.818	1.336E-38	318	0.464	0.421	A0A178UJ48.pdb.gz	A0A178UJ48_ARATH tRNA (adenine(58)-N(1))-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=At5g14600 PE=1 SV=1
4	AFDB:O14307	0.874	0.699	3.834E-34	364	0.381	0.302	O14307.pdb.gz	TRM61_SCHPO tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit trm61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cpd1 PE=3 SV=1
5	AFDB:P46959	0.875	0.667	4.255E-32	383	0.405	0.305	P46959.pdb.gz	TRM61_YEAST tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD14 PE=1 SV=1
6	PDB:5ergB	0.881	0.789	9.266E-31	324	0.394	0.352	5ergB.pdb.gz	Crystal structure of the two-subunit tRNA m(1)A58 methyltransferase TRM6-TRM61 from Saccharomyces cerevisiae.
7	PDB:1i9gA	0.820	0.894	1.236E-21	264	0.232	0.254	1i9gA.pdb.gz	Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
8	AFDB:Q9BVS5	0.802	0.499	3.658E-21	477	0.218	0.132	Q9BVS5.pdb.gz	TR61B_HUMAN tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TRMT61B PE=1 SV=2
9	AFDB:P9WFZ1	0.808	0.833	9.049E-21	280	0.232	0.239	P9WFZ1.pdb.gz	TRMI_MYCTU tRNA (adenine(58)-N(1))-methyltransferase TrmI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=trmI PE=1 SV=1
10	AFDB:Q8GBB2	0.786	0.885	2.358E-19	255	0.221	0.251	Q8GBB2.pdb.gz	TRMI_THET2 tRNA (adenine(58)-N(1))-methyltransferase TrmI OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=trmI PE=1 SV=2
11	PDB:2pwyA	0.770	0.879	2.362E-19	251	0.218	0.251	2pwyA.pdb.gz	Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.
12	AFDB:Q38A72	0.695	0.438	1.537E-11	476	0.208	0.126	Q38A72.pdb.gz	Q38A72_TRYB2 tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1410 PE=3 SV=1
13	PDB:5cd1B	0.646	0.586	1.845E-11	321	0.180	0.162	5cd1B.pdb.gz	Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
14	PDB:5ergA	0.682	0.589	9.418E-11	340	0.131	0.112	5ergA.pdb.gz	Crystal structure of the two-subunit tRNA m(1)A58 methyltransferase TRM6-TRM61 from Saccharomyces cerevisiae.
15	PDB:5ccbB	0.650	0.516	1.622E-10	371	0.159	0.124	5ccbB.pdb.gz	Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
16	AFDB:P9WGA9	0.489	0.375	7.780E-10	390	0.156	0.115	P9WGA9.pdb.gz	COBL_MYCTU Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cobL PE=1 SV=1
17	AFDB:Q9UJA5	0.684	0.410	3.314E-9	497	0.166	0.097	Q9UJA5.pdb.gz	TRM6_HUMAN tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6 PE=1 SV=1
18	PDB:6jclG	0.436	0.557	1.037E-7	219	0.138	0.183	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
19	PDB:3a25A	0.422	0.457	1.170E-7	264	0.107	0.117	3a25A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
20	PDB:7mq8SD	0.461	0.553	1.680E-7	237	0.114	0.139	7mq8SD.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96FX7	0.0	591	289	1.000	1.000	TRM61_HUMAN tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1
2	A0A178UJ48	2.03e-79	245	318	0.467	0.425	A0A178UJ48_ARATH tRNA (adenine(58)-N(1))-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=At5g14600 PE=1 SV=1
3	Q84K50	2.03e-79	245	318	0.467	0.425	Q84K50_ARATH tRNA (adenine(58)-N(1))-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM61 PE=1 SV=1
4	O14307	3.34e-59	194	364	0.339	0.269	TRM61_SCHPO tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit trm61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cpd1 PE=3 SV=1
5	P46959	6.50e-56	186	383	0.363	0.274	TRM61_YEAST tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD14 PE=1 SV=1
6	P9WFZ1	3.61e-16	79.0	280	0.228	0.236	TRMI_MYCTU tRNA (adenine(58)-N(1))-methyltransferase TrmI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=trmI PE=1 SV=1
7	Q8GBB2	2.41e-07	53.1	255	0.166	0.188	TRMI_THET2 tRNA (adenine(58)-N(1))-methyltransferase TrmI OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=trmI PE=1 SV=2
8	Q9BVS5	1.30e-05	48.5	477	0.166	0.101	TR61B_HUMAN tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TRMT61B PE=1 SV=2
9	P9WJZ7	0.012	38.5	224	0.093	0.121	Y1220_MYCTU Probable O-methyltransferase Rv1220c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1220c PE=1 SV=2
10	Q2EMV9	0.013	39.7	1817	0.090	0.014	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
11	Q388E0	0.055	36.6	228	0.121	0.154	Q388E0_TRYB2 Fibrillarin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2040 PE=3 SV=1
12	Q388C9	0.060	37.0	304	0.128	0.122	Q388C9_TRYB2 Fibrillarin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1920 PE=3 SV=1
13	E9QV42	0.069	36.6	312	0.138	0.128	E9QV42_ASPFU rRNA 2'-O-methyltransferase fibrillarin OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G14220 PE=3 SV=1
14	Q96MG8	0.33	34.7	357	0.107	0.087	PCMD1_HUMAN Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PCMTD1 PE=1 SV=2
15	P35551	0.52	33.9	305	0.128	0.121	FBRL_SCHPO rRNA 2'-O-methyltransferase fibrillarin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fib1 PE=1 SV=1
16	Q6PIM4	1.4	32.7	282	0.055	0.057	Q6PIM4_HUMAN PCMTD2 protein OS=Homo sapiens OX=9606 GN=PCMTD2 PE=1 SV=1
17	Q9URZ1	1.5	32.3	230	0.052	0.065	PIMT_SCHPO Probable protein-L-isoaspartate O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcm2 PE=3 SV=1
18	Q9NV79	1.7	32.3	361	0.055	0.044	PCMD2_HUMAN Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCMTD2 PE=1 SV=2
19	Q9FK02	2.3	32.0	380	0.055	0.042	DIM1B_ARATH Ribosomal RNA small subunit methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIM1B PE=1 SV=1
20	F9UN54	4.3	31.2	359	0.066	0.053	F9UN54_LACPL Oligopeptide ABC transporter, ATP-binding protein OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=oppD PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14481 Fimbrial_PilY2	5.1e+02	11.7	Type 4 fimbrial biogenesis protein PilY2
2	PF08704 GCD14	2e-101	350.4	tRNA methyltransferase complex GCD14 subunit
3	PF14801 GCD14_N	1.6	19.9	tRNA methyltransferase complex GCD14 subunit N-term
4	PF08242 Methyltransf_12	87	15.3	Methyltransferase domain
5	PF13578 Methyltransf_24	18	17.8	Methyltransferase domain
6	PF13847 Methyltransf_31	1.5	20.0	Methyltransferase domain
7	PF01135 PCMT	6.5	18.0	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374399

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000203001	0.999	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
2	9606.ENSP00000314441	0.996	tRNA (guanine-N(7)-)-methyltransferase
3	9606.ENSP00000381266	0.954	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
4	9606.ENSP00000346280	0.940	tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like
5	9606.ENSP00000303584	0.933	HemK methyltransferase family member 2
6	9606.ENSP00000333934	0.925	tRNA (guanine(10)-N2)-methyltransferase homolog
7	9606.ENSP00000396673	0.920	pre-rRNA processing protein FTSJ3
8	9606.ENSP00000438349	0.890	Multifunctional methyltransferase subunit TRM112-like protein
9	9606.ENSP00000302801	0.880	tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial
10	9606.ENSP00000273962	0.875	tRNA methyltransferase 10 homolog A
11	9606.ENSP00000326948	0.873	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
12	9606.ENSP00000371858	0.873	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
13	9606.ENSP00000261249	0.871	tRNA (guanine(37)-N1)-methyltransferase
14	9606.ENSP00000238146	0.846	ATP-dependent RNA helicase DDX55
15	9606.ENSP00000455106	0.842	Ribosome biogenesis protein BOP1
16	9606.ENSP00000247003	0.839	Probable ATP-dependent RNA helicase DDX49
17	9606.ENSP00000253237	0.839	Glutamate-rich WD repeat-containing protein 1
18	9606.ENSP00000264670	0.837	tRNA (cytosine(34)-C(5))-methyltransferase
19	9606.ENSP00000223073	0.834	RNA-binding protein 28
20	9606.ENSP00000332448	0.833	Probable inactive tRNA-specific adenosine deaminase-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008174	0.999	mRNA methyltransferase activity
GO:0061953	0.462	mRNA (adenine-N1-)-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016556	0.995	mRNA modification
GO:0006400	0.966	tRNA modification
GO:0044260	0.948	cellular macromolecule metabolic process
GO:0032259	0.938	methylation
GO:0001510	0.916	RNA methylation
GO:0030488	0.892	tRNA methylation
GO:0050789	0.345	regulation of biological process
GO:0050794	0.320	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:1902494	0.958	catalytic complex
GO:1990234	0.925	transferase complex
GO:0034708	0.920	methyltransferase complex
GO:0005737	0.800	cytoplasm
GO:0005829	0.693	cytosol
GO:0043232	0.521	intracellular non-membrane-bounded organelle
GO:0043527	0.449	tRNA methyltransferase complex
GO:0031515	0.437	tRNA (m1A) methyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]