StarFunc result for job id Q96FX8

User Input

>input (193 residues)
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGS
YEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDL
LGNAKPRYFYTSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FX8	1.000	1.000	2.492E-30	193	1.000	1.000	Q96FX8.pdb.gz	PERP_HUMAN p53 apoptosis effector related to PMP-22 OS=Homo sapiens OX=9606 GN=PERP PE=1 SV=1
2	AFDB:E9QHT9	0.885	0.922	2.190E-16	185	0.466	0.486	E9QHT9.pdb.gz	E9QHT9_DANRE P53 apoptosis effector related to PMP-22 OS=Danio rerio OX=7955 GN=fk24g11 PE=3 SV=1
3	AFDB:Q9BQJ4	0.736	0.783	4.742E-9	181	0.285	0.304	Q9BQJ4.pdb.gz	TMM47_HUMAN Transmembrane protein 47 OS=Homo sapiens OX=9606 GN=TMEM47 PE=1 SV=1
4	AFDB:Q8NHS1	0.687	0.787	5.581E-7	167	0.161	0.186	Q8NHS1.pdb.gz	CLDN2_HUMAN Claudin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CLDND2 PE=1 SV=1
5	AFDB:G5ED30	0.735	0.677	6.498E-7	211	0.176	0.161	G5ED30.pdb.gz	G5ED30_CAEEL Cell junction protein VAB-9 OS=Caenorhabditis elegans OX=6239 GN=vab-9 PE=1 SV=1
6	AFDB:P16646	0.643	0.760	1.026E-6	161	0.161	0.193	P16646.pdb.gz	PMP22_MOUSE Peripheral myelin protein 22 OS=Mus musculus OX=10090 GN=Pmp22 PE=1 SV=2
7	AFDB:Q91Y55	0.675	0.567	1.391E-6	235	0.187	0.153	Q91Y55.pdb.gz	CLD16_RAT Claudin-16 OS=Rattus norvegicus OX=10116 GN=Cldn16 PE=2 SV=1
8	AFDB:Q9VRM3	0.651	0.523	1.885E-6	247	0.212	0.166	Q9VRM3.pdb.gz	Q9VRM3_DROME Sinuous OS=Drosophila melanogaster OX=7227 GN=sinu PE=1 SV=3
9	AFDB:Q8VHW8	0.715	0.520	2.086E-6	275	0.192	0.135	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
10	AFDB:P56857	0.680	0.512	2.556E-6	264	0.223	0.163	P56857.pdb.gz	CLD18_MOUSE Claudin-18 OS=Mus musculus OX=10090 GN=Cldn18 PE=1 SV=1
11	PDB:7rz4A	0.706	0.153	5.400E-6	993	0.161	0.031	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
12	PDB:7ocaI	0.664	0.690	5.977E-6	185	0.166	0.173	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
13	PDB:6ov2A	0.657	0.693	3.029E-5	182	0.145	0.154	6ov2A.pdb.gz
14	PDB:5b2gC	0.638	0.376	1.254E-4	350	0.187	0.103	5b2gC.pdb.gz
15	PDB:7rzaA	0.619	0.140	1.387E-4	981	0.166	0.033	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:5kbtA	0.662	0.149	1.700E-4	973	0.166	0.033	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
17	PDB:6jp5E	0.625	0.706	5.187E-4	169	0.155	0.178	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
18	PDB:5weoA	0.642	0.140	5.457E-4	988	0.166	0.032	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:6c14B	0.534	0.616	9.831E-3	164	0.135	0.159	6c14B.pdb.gz
20	PDB:6wxuB	0.545	0.399	1.718E-2	273	0.161	0.114	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96FX8	2.90e-140	390	193	1.000	1.000	PERP_HUMAN p53 apoptosis effector related to PMP-22 OS=Homo sapiens OX=9606 GN=PERP PE=1 SV=1
2	Q9JK95	4.99e-118	334	193	0.907	0.907	PERP_MOUSE p53 apoptosis effector related to PMP-22 OS=Mus musculus OX=10090 GN=Perp PE=1 SV=1
3	E9QHT9	5.32e-39	134	185	0.472	0.492	E9QHT9_DANRE P53 apoptosis effector related to PMP-22 OS=Danio rerio OX=7955 GN=fk24g11 PE=3 SV=1
4	Q9BQJ4	5.58e-19	82.0	181	0.264	0.282	TMM47_HUMAN Transmembrane protein 47 OS=Homo sapiens OX=9606 GN=TMEM47 PE=1 SV=1
5	Q9JJG6	1.21e-18	81.3	181	0.264	0.282	TMM47_MOUSE Transmembrane protein 47 OS=Mus musculus OX=10090 GN=Tmem47 PE=1 SV=1
6	D3ZK93	0.026	37.0	322	0.181	0.109	GSG1L_RAT Germ cell-specific gene 1-like protein OS=Rattus norvegicus OX=10116 GN=Gsg1l PE=1 SV=1
7	D3Z7H4	0.062	35.8	322	0.176	0.106	GSG1L_MOUSE Germ cell-specific gene 1-like protein OS=Mus musculus OX=10090 GN=Gsg1l PE=1 SV=2
8	Q09917	0.32	33.9	710	0.119	0.032	PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkd2 PE=1 SV=1
9	Q18299	0.35	33.9	449	0.098	0.042	NHR43_CAEEL Nuclear hormone receptor family member nhr-43 OS=Caenorhabditis elegans OX=6239 GN=nhr-43 PE=2 SV=1
10	G5ED30	0.51	32.7	211	0.098	0.090	G5ED30_CAEEL Cell junction protein VAB-9 OS=Caenorhabditis elegans OX=6239 GN=vab-9 PE=1 SV=1
11	Q9SWH4	1.3	32.0	323	0.073	0.043	SYP42_ARATH Syntaxin-42 OS=Arabidopsis thaliana OX=3702 GN=SYP42 PE=1 SV=1
12	Q01453	3.1	30.0	160	0.161	0.194	PMP22_HUMAN Peripheral myelin protein 22 OS=Homo sapiens OX=9606 GN=PMP22 PE=1 SV=1
13	P97707	5.2	29.6	223	0.150	0.130	CCG1_RAT Voltage-dependent calcium channel gamma-1 subunit OS=Rattus norvegicus OX=10116 GN=Cacng1 PE=1 SV=1
14	Q8GWG6	6.6	30.0	623	0.114	0.035	MBRL_ARATH Membralin-like protein At1g60995 OS=Arabidopsis thaliana OX=3702 GN=At1g60995 PE=2 SV=1
15	Q06432	6.9	29.3	222	0.155	0.135	CCG1_HUMAN Voltage-dependent calcium channel gamma-1 subunit OS=Homo sapiens OX=9606 GN=CACNG1 PE=1 SV=1
16	Q8VHW8	7.7	29.3	275	0.109	0.076	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	3	19.1	PMP-22/EMP/MP20/Claudin tight junction
2	PF19752 DUF6239	7.7e+02	11.4	Family of unknown function (DUF6239)
3	PF00822 PMP22_Claudin	4.6e-07	41.4	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.965	Cellular tumor antigen p53
2	9606.ENSP00000264731	0.963	Tumor protein 63
3	9606.ENSP00000369129	0.862	Desmoplakin
4	9606.ENSP00000353608	0.849	Desmocollin-3
5	9606.ENSP00000261590	0.847	Desmoglein-2
6	9606.ENSP00000331678	0.847	Plakophilin-3
7	9606.ENSP00000263946	0.820	Plakophilin-1
8	9606.ENSP00000070846	0.792	Plakophilin-2
9	9606.ENSP00000280904	0.788	Desmocollin-2
10	9606.ENSP00000257192	0.775	Desmoglein-1
11	9606.ENSP00000377508	0.771	Junction plakoglobin
12	9606.ENSP00000311221	0.769	Zinc finger matrin-type protein 3
13	9606.ENSP00000257189	0.751	Desmoglein-3
14	9606.ENSP00000352785	0.748	Desmoglein-4
15	9606.ENSP00000257198	0.743	Desmocollin-1
16	9606.ENSP00000374409	0.698	Plakophilin-4
17	9606.ENSP00000278903	0.663	Etoposide-induced protein 2.4 homolog
18	9606.ENSP00000263915	0.662	Growth factor receptor-bound protein 14
19	9606.ENSP00000326119	0.653	Phorbol-12-myristate-13-acetate-induced protein 1
20	9606.ENSP00000363017	0.643	Replication protein A 32 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048518	0.983	positive regulation of biological process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0071704	0.982	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0050794	0.977	regulation of cellular process
GO:0080090	0.975	regulation of primary metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0009987	0.972	cellular process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0043170	0.968	macromolecule metabolic process
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0051173	0.956	positive regulation of nitrogen compound metabolic process
GO:0065009	0.953	regulation of molecular function
GO:1901564	0.952	organonitrogen compound metabolic process
GO:0051336	0.932	regulation of hydrolase activity
GO:0006508	0.926	proteolysis
GO:0043085	0.914	positive regulation of catalytic activity
GO:0051247	0.910	positive regulation of protein metabolic process
GO:0052548	0.878	regulation of endopeptidase activity
GO:0051604	0.869	protein maturation
GO:0051345	0.864	positive regulation of hydrolase activity
GO:2000116	0.858	regulation of cysteine-type endopeptidase activity
GO:0010952	0.845	positive regulation of peptidase activity
GO:2001056	0.837	positive regulation of cysteine-type endopeptidase activity
GO:0008219	0.798	cell death
GO:0016485	0.756	protein processing
GO:0050896	0.746	response to stimulus
GO:0031638	0.718	zymogen activation
GO:0006915	0.617	apoptotic process
GO:0007154	0.569	cell communication
GO:0051716	0.544	cellular response to stimulus
GO:0023052	0.535	signaling
GO:0071840	0.506	cellular component organization or biogenesis
GO:0048856	0.496	anatomical structure development
GO:0016043	0.461	cellular component organization
GO:0048522	0.385	positive regulation of cellular process
GO:0007165	0.330	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005737	0.968	cytoplasm
GO:0012505	0.956	endomembrane system
GO:0005739	0.569	mitochondrion
GO:0005634	0.491	nucleus
GO:0005794	0.448	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]