StarFunc result for job id Q96FZ7

User Input

>input (201 residues)
MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERA
KLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQFGNECLNKMHQVMSI
EEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPE
KIPENVPVKARPRQAELVAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96FZ7	1.000	1.000	9.144E-27	201	1.000	1.000	Q96FZ7.pdb.gz	CHMP6_HUMAN Charged multivesicular body protein 6 OS=Homo sapiens OX=9606 GN=CHMP6 PE=1 SV=3
2	AFDB:Q9W236	0.741	0.707	2.617E-15	212	0.522	0.495	Q9W236.pdb.gz	Q9W236_DROME Vacuolar protein sorting 20, isoform A OS=Drosophila melanogaster OX=7227 GN=Vps20 PE=1 SV=1
3	AFDB:Q8GXN6	0.559	0.515	4.323E-11	219	0.373	0.342	Q8GXN6.pdb.gz	VP201_ARATH Vacuolar protein sorting-associated protein 20 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS20.1 PE=1 SV=1
4	AFDB:Q9FY89	0.577	0.539	5.914E-11	216	0.388	0.361	Q9FY89.pdb.gz	VP202_ARATH Vacuolar protein sorting-associated protein 20 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS20.2 PE=1 SV=1
5	AFDB:Q5AH99	0.556	0.519	4.392E-10	216	0.333	0.310	Q5AH99.pdb.gz	Q5AH99_CANAL ESCRT-III subunit protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS20 PE=4 SV=1
6	AFDB:F4KC57	0.562	0.468	1.056E-9	243	0.368	0.305	F4KC57.pdb.gz	F4KC57_ARATH SNF7 family protein OS=Arabidopsis thaliana OX=3702 GN=VPS201 PE=1 SV=1
7	AFDB:O94318	0.593	0.538	1.468E-8	226	0.303	0.270	O94318.pdb.gz	VPS20_SCHPO Vacuolar protein sorting-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps20 PE=3 SV=1
8	AFDB:Q5ABD0	0.529	0.478	3.113E-8	226	0.303	0.270	Q5ABD0.pdb.gz	SNF7_CANAL Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF7 PE=3 SV=1
9	AFDB:Q86H98	0.550	0.519	6.202E-8	215	0.254	0.237	Q86H98.pdb.gz	CHMP4_DICDI Charged multivesicular body protein 4 OS=Dictyostelium discoideum OX=44689 GN=chmp4 PE=3 SV=1
10	AFDB:Q04272	0.555	0.507	7.968E-8	221	0.284	0.258	Q04272.pdb.gz	VPS20_YEAST Vacuolar protein sorting-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS20 PE=1 SV=3
11	PDB:6tz402	0.406	0.458	9.453E-3	176	0.129	0.148	6tz402.pdb.gz
12	PDB:3euhB	0.273	0.182	7.133E-1	321	0.109	0.069	3euhB.pdb.gz
13	PDB:6v4uB	0.226	0.132	8.608E-1	421	0.095	0.045	6v4uB.pdb.gz
14	PDB:5bw9g	0.225	0.296	1.254	141	0.070	0.099	5bw9g.pdb.gz
15	PDB:6r1mB	0.349	0.169	1.335	428	0.065	0.030	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
16	PDB:6wg3D	0.202	0.058	1.335	932	0.090	0.019	6wg3D.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
17	PDB:6vq9H	0.286	0.433	1.513	109	0.065	0.119	6vq9H.pdb.gz	Structure of V-ATPase from the mammalian brain.
18	PDB:3frtB	0.412	0.580	1.611	142	0.035	0.049	3frtB.pdb.gz
19	PDB:4q4aA	0.405	0.153	1.715	572	0.075	0.026	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
20	PDB:7emfD	0.302	0.368	1.826	158	0.144	0.184	7emfD.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96FZ7	1.72e-142	397	201	1.000	1.000	CHMP6_HUMAN Charged multivesicular body protein 6 OS=Homo sapiens OX=9606 GN=CHMP6 PE=1 SV=3
2	Q9W236	4.23e-60	188	212	0.527	0.500	Q9W236_DROME Vacuolar protein sorting 20, isoform A OS=Drosophila melanogaster OX=7227 GN=Vps20 PE=1 SV=1
3	Q8GXN6	1.82e-34	123	219	0.383	0.352	VP201_ARATH Vacuolar protein sorting-associated protein 20 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS20.1 PE=1 SV=1
4	Q9FY89	4.30e-34	122	216	0.383	0.356	VP202_ARATH Vacuolar protein sorting-associated protein 20 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS20.2 PE=1 SV=1
5	Q5AH99	4.00e-29	109	216	0.338	0.315	Q5AH99_CANAL ESCRT-III subunit protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS20 PE=4 SV=1
6	F4KC57	5.65e-29	110	243	0.383	0.317	F4KC57_ARATH SNF7 family protein OS=Arabidopsis thaliana OX=3702 GN=VPS201 PE=1 SV=1
7	O94318	5.76e-27	104	226	0.323	0.288	VPS20_SCHPO Vacuolar protein sorting-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps20 PE=3 SV=1
8	Q04272	6.45e-21	88.2	221	0.274	0.249	VPS20_YEAST Vacuolar protein sorting-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS20 PE=1 SV=3
9	Q8SY83	2.49e-16	73.6	111	0.234	0.423	Q8SY83_DROME RH31535p OS=Drosophila melanogaster OX=7227 GN=Vps20 PE=2 SV=1
10	P39929	2.11e-13	68.6	240	0.269	0.225	SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF7 PE=1 SV=1
11	Q5ABD0	1.44e-11	63.5	226	0.209	0.186	SNF7_CANAL Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF7 PE=3 SV=1
12	Q86K93	4.59e-10	60.5	477	0.239	0.101	CHMP7_DICDI Charged multivesicular body protein 7 OS=Dictyostelium discoideum OX=44689 GN=chmp7 PE=3 SV=1
13	Q8T0Q4	1.27e-09	58.2	226	0.269	0.239	Q8T0Q4_DROME GH13992p OS=Drosophila melanogaster OX=7227 GN=shrb PE=1 SV=1
14	Q9BY43	5.10e-08	53.5	222	0.179	0.162	CHM4A_HUMAN Charged multivesicular body protein 4a OS=Homo sapiens OX=9606 GN=CHMP4A PE=1 SV=3
15	Q86H98	7.08e-08	52.8	215	0.244	0.228	CHMP4_DICDI Charged multivesicular body protein 4 OS=Dictyostelium discoideum OX=44689 GN=chmp4 PE=3 SV=1
16	O82197	6.71e-07	50.1	213	0.259	0.244	VP321_ARATH Vacuolar protein sorting-associated protein 32 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS32.1 PE=1 SV=1
17	Q6IQ73	4.28e-06	47.8	224	0.229	0.205	CHM4C_DANRE Charged multivesicular body protein 4c OS=Danio rerio OX=7955 GN=chmp4c PE=2 SV=1
18	Q96CF2	6.39e-06	47.4	233	0.214	0.185	CHM4C_HUMAN Charged multivesicular body protein 4c OS=Homo sapiens OX=9606 GN=CHMP4C PE=1 SV=1
19	Q9D8B3	6.93e-04	41.6	224	0.199	0.179	CHM4B_MOUSE Charged multivesicular body protein 4b OS=Mus musculus OX=10090 GN=Chmp4b PE=1 SV=2
20	D4A9Z8	0.001	40.8	224	0.199	0.179	D4A9Z8_RAT Chromatin modifying protein 4B-like 1 OS=Rattus norvegicus OX=10116 GN=Chmp4bl1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10459 Peptidase_S46	6.5e+02	10.3	Peptidase S46
2	PF03357 Snf7	8.9e-38	141.1	Snf7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000015735

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000014711	0.993	Vacuolar protein sorting 25 homolog (S. cerevisiae)
2	60711.ENSCSAP00000013687	0.988	Vacuolar protein sorting 36 homolog (S. cerevisiae)
3	60711.ENSCSAP00000008403	0.976	Charged multivesicular body protein 4B
4	60711.ENSCSAP00000015550	0.974	Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs.
5	60711.ENSCSAP00000012412	0.965	annotation not available
6	60711.ENSCSAP00000016440	0.964	Charged multivesicular body protein 2A
7	60711.ENSCSAP00000000479	0.956	Belongs to the AAA ATPase family.
8	60711.ENSCSAP00000014210	0.956	Vacuolar protein sorting 4 homolog B (S. cerevisiae)
9	60711.ENSCSAP00000004690	0.911	Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process
10	60711.ENSCSAP00000009400	0.894	Charged multivesicular body protein 4C
11	60711.ENSCSAP00000006205	0.886	Charged multivesicular body protein 5
12	60711.ENSCSAP00000012057	0.873	Charged multivesicular body protein 4A
13	60711.ENSCSAP00000013096	0.867	Vesicle (multivesicular body) trafficking 1
14	60711.ENSCSAP00000001374	0.865	Tumor susceptibility 101
15	60711.ENSCSAP00000015952	0.857	VPS37B, ESCRT-I subunit
16	60711.ENSCSAP00000015242	0.848	Charged multivesicular body protein 1A
17	60711.ENSCSAP00000000616	0.847	IST1, ESCRT-III associated factor
18	60711.ENSCSAP00000002231	0.823	Charged multivesicular body protein 2B
19	60711.ENSCSAP00000001378	0.792	UEV and lactate/malate dehyrogenase domains
20	60711.ENSCSAP00000009821	0.785	Multivesicular body subunit 12B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0044265	0.988	cellular macromolecule catabolic process
GO:0051603	0.988	proteolysis involved in protein catabolic process
GO:0071985	0.986	multivesicular body sorting pathway
GO:0050794	0.985	regulation of cellular process
GO:0006996	0.985	organelle organization
GO:0051649	0.985	establishment of localization in cell
GO:0016236	0.985	macroautophagy
GO:0010256	0.984	endomembrane system organization
GO:0044085	0.980	cellular component biogenesis
GO:0051128	0.980	regulation of cellular component organization
GO:0046907	0.978	intracellular transport
GO:0043162	0.971	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0097352	0.968	autophagosome maturation
GO:0046755	0.967	viral budding
GO:0032886	0.967	regulation of microtubule-based process
GO:1903047	0.967	mitotic cell cycle process
GO:0061024	0.966	membrane organization
GO:0016050	0.966	vesicle organization
GO:0022607	0.963	cellular component assembly
GO:0044091	0.962	membrane biogenesis
GO:0044087	0.962	regulation of cellular component biogenesis
GO:0000280	0.960	nuclear division
GO:0033043	0.956	regulation of organelle organization
GO:0048519	0.954	negative regulation of biological process
GO:0050896	0.938	response to stimulus
GO:0051301	0.937	cell division
GO:0006998	0.936	nuclear envelope organization
GO:0007041	0.933	lysosomal transport
GO:0000070	0.929	mitotic sister chromatid segregation
GO:0006950	0.924	response to stress
GO:0071763	0.920	nuclear membrane organization
GO:0010564	0.919	regulation of cell cycle process
GO:0061640	0.919	cytoskeleton-dependent cytokinesis
GO:0070507	0.919	regulation of microtubule cytoskeleton organization
GO:0007080	0.919	mitotic metaphase plate congression
GO:0007032	0.917	endosome organization
GO:0023051	0.912	regulation of signaling
GO:0071709	0.910	membrane assembly
GO:0060236	0.908	regulation of mitotic spindle organization
GO:0000281	0.903	mitotic cytokinesis
GO:0048523	0.892	negative regulation of cellular process
GO:0001778	0.878	plasma membrane repair
GO:0019222	0.834	regulation of metabolic process
GO:0010646	0.834	regulation of cell communication
GO:0060255	0.775	regulation of macromolecule metabolic process
GO:1902115	0.761	regulation of organelle assembly
GO:0044000	0.754	movement in host
GO:0035891	0.733	exit from host cell
GO:0051171	0.719	regulation of nitrogen compound metabolic process
GO:0080090	0.718	regulation of primary metabolic process
GO:0070925	0.684	organelle assembly
GO:0048583	0.614	regulation of response to stimulus
GO:0051246	0.599	regulation of protein metabolic process
GO:1902410	0.535	mitotic cytokinetic process
GO:0031323	0.523	regulation of cellular metabolic process
GO:0009892	0.511	negative regulation of metabolic process
GO:0009966	0.491	regulation of signal transduction
GO:0010605	0.440	negative regulation of macromolecule metabolic process
GO:0048518	0.381	positive regulation of biological process
GO:0010941	0.341	regulation of cell death
GO:0060548	0.332	negative regulation of cell death
GO:0048522	0.327	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005768	0.999	endosome
GO:0032991	0.997	protein-containing complex
GO:0030659	0.997	cytoplasmic vesicle membrane
GO:0005886	0.996	plasma membrane
GO:0098588	0.996	bounding membrane of organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005634	0.994	nucleus
GO:0010008	0.993	endosome membrane
GO:0005576	0.992	extracellular region
GO:0065010	0.980	extracellular membrane-bounded organelle
GO:0099080	0.978	supramolecular complex
GO:0098796	0.978	membrane protein complex
GO:0005773	0.978	vacuole
GO:0036452	0.976	ESCRT complex
GO:0005819	0.975	spindle
GO:0005774	0.972	vacuolar membrane
GO:0099513	0.968	polymeric cytoskeletal fiber
GO:0005764	0.963	lysosome
GO:0005874	0.952	microtubule
GO:0005770	0.947	late endosome
GO:0030496	0.945	midbody
GO:1903561	0.922	extracellular vesicle
GO:0005694	0.907	chromosome
GO:0031975	0.906	envelope
GO:0070062	0.904	extracellular exosome
GO:0031967	0.892	organelle envelope
GO:0005776	0.891	autophagosome
GO:0000421	0.872	autophagosome membrane
GO:0140513	0.866	nuclear protein-containing complex
GO:0098852	0.861	lytic vacuole membrane
GO:0005771	0.844	multivesicular body
GO:0031902	0.835	late endosome membrane
GO:0005635	0.820	nuclear envelope
GO:0005876	0.816	spindle microtubule
GO:0098687	0.815	chromosomal region
GO:0005828	0.809	kinetochore microtubule
GO:0032585	0.809	multivesicular body membrane
GO:0000775	0.800	chromosome, centromeric region
GO:0000793	0.797	condensed chromosome
GO:0000776	0.791	kinetochore
GO:0005643	0.777	nuclear pore
GO:0005765	0.757	lysosomal membrane
GO:0031974	0.435	membrane-enclosed lumen
GO:0070013	0.433	intracellular organelle lumen
GO:0031981	0.415	nuclear lumen
GO:0000815	0.395	ESCRT III complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]