StarFunc result for job id Q96G03

User Input

>input (612 residues)
MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTA
GLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRF
ARLAATTFISQGIPVYLFSDITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDN
GAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHR
SVNRETKVKFVHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGK
GVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWK
EKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVL
FAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKAS
YFICHDQETIKKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSK
SSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFF
QPQKYNLQPKAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TSV4	0.992	0.979	0.000	620	0.922	0.910	Q7TSV4.pdb.gz	PGM2_MOUSE Phosphopentomutase OS=Mus musculus OX=10090 GN=Pgm2 PE=1 SV=1
2	AFDB:Q6PCE3	0.972	0.956	1.921E-92	622	0.588	0.579	Q6PCE3.pdb.gz	PGM2L_HUMAN Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3
3	AFDB:O45934	0.938	0.964	1.785E-77	595	0.458	0.471	O45934.pdb.gz	O45934_CAEEL Phosphoglucomutase-2 OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F4B.5 PE=1 SV=1
4	AFDB:O74478	0.914	0.953	5.679E-69	587	0.417	0.434	O74478.pdb.gz	PGM3_SCHPO Probable phosphoribomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1840.05c PE=1 SV=1
5	AFDB:Q03262	0.924	0.909	4.593E-65	622	0.391	0.384	Q03262.pdb.gz	PGM3_YEAST Phosphoribomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRM15 PE=1 SV=1
6	AFDB:O53360	0.770	0.876	1.350E-45	534	0.296	0.339	O53360.pdb.gz	O53360_MYCTU Probable phosphomannomutase PmmB (Phosphomannose mutase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmmB PE=1 SV=1
7	AFDB:Q86DA0	0.514	0.683	3.096E-37	459	0.245	0.327	Q86DA0.pdb.gz	Q86DA0_CAEEL Phosphoglucomutase OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F4B.5 PE=1 SV=1
8	AFDB:P95090	0.663	0.736	9.847E-29	547	0.190	0.212	P95090.pdb.gz	P95090_MYCTO Phosphoglucomutase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pgmA PE=3 SV=1
9	AFDB:P36938	0.678	0.753	3.269E-28	546	0.185	0.207	P36938.pdb.gz	PGM_ECOLI Phosphoglucomutase OS=Escherichia coli (strain K12) OX=83333 GN=pgm PE=1 SV=1
10	AFDB:P74643	0.679	0.728	7.727E-27	567	0.163	0.176	P74643.pdb.gz	P74643_SYNY3 Phosphoglucomutase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=pgm PE=1 SV=1
11	PDB:4il8A	0.628	0.817	6.163E-23	459	0.144	0.192	4il8A.pdb.gz	Identification of an essential active-site residue in the alpha-D-phosphohexomutase enzyme superfamily.
12	PDB:6snoA	0.674	0.716	3.342E-22	573	0.194	0.208	6snoA.pdb.gz	Structural basis for substrate and product recognition in human phosphoglucomutase-1 (PGM1) isoform 2, a member of the alpha-D-phosphohexomutase superfamily.
13	PDB:5f9cB	0.643	0.727	1.038E-20	536	0.178	0.203	5f9cB.pdb.gz	Induced Structural Disorder as a Molecular Mechanism for Enzyme Dysfunction in Phosphoglucomutase 1 Deficiency.
14	PDB:7s0wB	0.602	0.727	1.502E-19	499	0.180	0.220	7s0wB.pdb.gz	Effects of the T337M and G391V disease-related variants on human phosphoglucomutase 1: structural disruptions large and small.
15	PDB:3k40A	0.122	0.158	2.686E-4	448	0.060	0.083	3k40A.pdb.gz
16	PDB:6sr6C	0.104	0.117	7.898E-3	524	0.082	0.095	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
17	PDB:3c6kD	0.106	0.165	8.808E-3	348	0.029	0.052	3c6kD.pdb.gz	Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
18	PDB:3donA	0.170	0.307	9.302E-3	264	0.052	0.121	3donA.pdb.gz
19	PDB:2hufA	0.089	0.126	1.095E-2	385	0.062	0.099	2hufA.pdb.gz	Crystal Structures of Aedes aegypti Alanine Glyoxylate Aminotransferase.
20	PDB:6jrlA	0.116	0.146	1.290E-2	465	0.054	0.071	6jrlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O45934	0.0	553	595	0.461	0.474	O45934_CAEEL Phosphoglucomutase-2 OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F4B.5 PE=1 SV=1
2	Q6PCE3	0.0	768	622	0.596	0.587	PGM2L_HUMAN Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3
3	Q7TSV4	0.0	1191	620	0.922	0.910	PGM2_MOUSE Phosphopentomutase OS=Mus musculus OX=10090 GN=Pgm2 PE=1 SV=1
4	Q96G03	0.0	1277	612	1.000	1.000	PGM2_HUMAN Phosphopentomutase OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4
5	O74478	3.19e-160	473	587	0.426	0.445	PGM3_SCHPO Probable phosphoribomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1840.05c PE=1 SV=1
6	Q03262	1.44e-130	398	622	0.404	0.397	PGM3_YEAST Phosphoribomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRM15 PE=1 SV=1
7	Q86DA0	1.96e-94	299	459	0.243	0.325	Q86DA0_CAEEL Phosphoglucomutase OS=Caenorhabditis elegans OX=6239 GN=CELE_Y43F4B.5 PE=1 SV=1
8	O53360	1.16e-64	223	534	0.306	0.350	O53360_MYCTU Probable phosphomannomutase PmmB (Phosphomannose mutase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmmB PE=1 SV=1
9	P95090	4.99e-06	52.0	547	0.175	0.196	P95090_MYCTO Phosphoglucomutase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pgmA PE=3 SV=1
10	F4I6W4	1.44e-04	47.4	662	0.155	0.144	F4I6W4_ARATH phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) OS=Arabidopsis thaliana OX=3702 GN=PGM2 PE=1 SV=1
11	P74643	3.64e-04	45.8	567	0.163	0.176	P74643_SYNY3 Phosphoglucomutase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=pgm PE=1 SV=1
12	P31120	8.66e-04	44.7	445	0.044	0.061	GLMM_ECOLI Phosphoglucosamine mutase OS=Escherichia coli (strain K12) OX=83333 GN=glmM PE=1 SV=3
13	Q9VUY9	0.001	44.7	560	0.211	0.230	PGM_DROME Phosphoglucomutase OS=Drosophila melanogaster OX=7227 GN=Pgm1 PE=1 SV=1
14	F4KH14	0.005	42.4	614	0.092	0.091	F4KH14_ARATH phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) OS=Arabidopsis thaliana OX=3702 GN=At5g17530 PE=1 SV=1
15	Q9HV50	0.009	41.2	445	0.036	0.049	GLMM_PSEAE Phosphoglucosamine mutase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=glmM PE=3 SV=1
16	Q6LYB4	0.014	40.8	447	0.039	0.054	GLMM_METMP Phosphoglucosamine mutase OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=glmM PE=1 SV=1
17	P38628	0.026	40.0	557	0.025	0.027	AGM1_YEAST Phosphoacetylglucosamine mutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCM1 PE=1 SV=2
18	Q9SCY0	0.053	38.9	623	0.092	0.090	PGMP_ARATH Phosphoglucomutase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGMP PE=1 SV=2
19	P26276	0.079	38.1	463	0.046	0.060	ALGC_PSEAE Phosphomannomutase/phosphoglucomutase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=algC PE=1 SV=4
20	O49299	0.18	37.4	583	0.149	0.156	PGMC1_ARATH Probable phosphoglucomutase, cytoplasmic 1 OS=Arabidopsis thaliana OX=3702 GN=At1g23190 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02878 PGM_PMM_I	8.1e-32	121.3	Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
2	PF02879 PGM_PMM_II	7.1e-21	86.1	Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
3	PF02880 PGM_PMM_III	3e-09	48.5	Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
4	PF00408 PGM_PMM_IV	0.03	25.9	Phosphoglucomutase/phosphomannomutase, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371393

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338703	0.980	UTP--glucose-1-phosphate uridylyltransferase
2	9606.ENSP00000360124	0.980	Phosphoglucomutase-1
3	9606.ENSP00000405573	0.970	Glucose-6-phosphate isomerase
4	9606.ENSP00000306817	0.962	Ribokinase
5	9606.ENSP00000354532	0.959	Purine nucleoside phosphorylase
6	9606.ENSP00000416583	0.959	Deoxyribose-phosphate aldolase
7	9606.ENSP00000391481	0.955	Transketolase
8	9606.ENSP00000283646	0.953	Ribose 5-phosphate isomerase A
9	9606.ENSP00000381504	0.935	Ribose-phosphate pyrophosphokinase 2
10	9606.ENSP00000402103	0.933	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
11	9606.ENSP00000290573	0.932	Hexokinase-2
12	9606.ENSP00000216962	0.931	Glycogen phosphorylase, brain form
13	9606.ENSP00000164139	0.930	Glycogen phosphorylase, muscle form
14	9606.ENSP00000294724	0.930	Glycogen debranching enzyme
15	9606.ENSP00000424595	0.930	Ribose-phosphate pyrophosphokinase 3
16	9606.ENSP00000280605	0.929	Transketolase-like protein 2
17	9606.ENSP00000358931	0.928	Transketolase-like protein 1
18	9606.ENSP00000361512	0.928	Ribose-phosphate pyrophosphokinase 1
19	9606.ENSP00000419628	0.927	ADP-sugar pyrophosphatase
20	9606.ENSP00000216392	0.925	Glycogen phosphorylase, liver form

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004614	0.999	phosphoglucomutase activity
GO:0005488	0.897	binding
GO:0005515	0.893	protein binding
GO:0016740	0.454	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044281	0.991	small molecule metabolic process
GO:0005975	0.975	carbohydrate metabolic process
GO:0006006	0.950	glucose metabolic process
GO:0009056	0.817	catabolic process
GO:1901575	0.809	organic substance catabolic process
GO:0006091	0.749	generation of precursor metabolites and energy
GO:0006807	0.686	nitrogen compound metabolic process
GO:0044248	0.460	cellular catabolic process
GO:0016052	0.438	carbohydrate catabolic process
GO:0015980	0.410	energy derivation by oxidation of organic compounds
GO:0043170	0.407	macromolecule metabolic process
GO:1901360	0.402	organic cyclic compound metabolic process
GO:0046483	0.402	heterocycle metabolic process
GO:0006725	0.336	cellular aromatic compound metabolic process
GO:0044260	0.335	cellular macromolecule metabolic process
GO:1901564	0.326	organonitrogen compound metabolic process
GO:0055086	0.316	nucleobase-containing small molecule metabolic process
GO:0005977	0.316	glycogen metabolic process
GO:1901135	0.311	carbohydrate derivative metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005576	0.996	extracellular region
GO:0070013	0.996	intracellular organelle lumen
GO:0070062	0.991	extracellular exosome
GO:0031410	0.770	cytoplasmic vesicle
GO:0099503	0.696	secretory vesicle
GO:0030141	0.674	secretory granule
GO:0034774	0.638	secretory granule lumen
GO:0101002	0.517	ficolin-1-rich granule
GO:0031981	0.493	nuclear lumen
GO:1904813	0.432	ficolin-1-rich granule lumen
GO:0005654	0.342	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23536	0.999	alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate
EC:5.4.2.2	0.999	phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
EC:2.-.-.-	0.454	Transferases.

[back to server]