StarFunc result for job id Q96G23

User Input

>input (380 residues)
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV
ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR
RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY
WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD
SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF
GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA
KSRPLANGHPILNNNHRKND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V8V4	0.926	0.926	1.193E-45	380	0.924	0.924	G3V8V4.pdb.gz	G3V8V4_RAT Ceramide synthase 2 OS=Rattus norvegicus OX=10116 GN=Cers2 PE=1 SV=1
2	AFDB:Q3T1K1	0.841	0.831	2.354E-39	385	0.787	0.777	Q3T1K1.pdb.gz	Q3T1K1_RAT Ceramide synthase 2 OS=Rattus norvegicus OX=10116 GN=Cers2 PE=1 SV=1
3	AFDB:E7F9X7	0.921	0.914	2.342E-36	383	0.647	0.642	E7F9X7.pdb.gz	E7F9X7_DANRE Ceramide synthase 2-like OS=Danio rerio OX=7955 GN=cers2b PE=1 SV=1
4	AFDB:Q9HA82	0.906	0.874	4.573E-32	394	0.479	0.462	Q9HA82.pdb.gz	CERS4_HUMAN Ceramide synthase 4 OS=Homo sapiens OX=9606 GN=CERS4 PE=1 SV=2
5	AFDB:Q1A3B0	0.864	0.858	6.087E-31	383	0.489	0.486	Q1A3B0.pdb.gz	CERS3_MOUSE Ceramide synthase 3 OS=Mus musculus OX=10090 GN=Cers3 PE=1 SV=1
6	AFDB:Q8IU89	0.876	0.869	1.951E-30	383	0.495	0.491	Q8IU89.pdb.gz	CERS3_HUMAN Ceramide synthase 3 OS=Homo sapiens OX=9606 GN=CERS3 PE=1 SV=2
7	AFDB:Q9D6J1	0.889	0.860	6.817E-30	393	0.439	0.425	Q9D6J1.pdb.gz	CERS4_MOUSE Ceramide synthase 4 OS=Mus musculus OX=10090 GN=Cers4 PE=1 SV=1
8	AFDB:Q8N5B7	0.865	0.839	4.406E-27	392	0.421	0.408	Q8N5B7.pdb.gz	CERS5_HUMAN Ceramide synthase 5 OS=Homo sapiens OX=9606 GN=CERS5 PE=1 SV=1
9	AFDB:Q6ZMG9	0.860	0.852	6.782E-27	384	0.413	0.409	Q6ZMG9.pdb.gz	CERS6_HUMAN Ceramide synthase 6 OS=Homo sapiens OX=9606 GN=CERS6 PE=1 SV=1
10	AFDB:Q9D6K9	0.865	0.797	3.347E-26	414	0.400	0.367	Q9D6K9.pdb.gz	CERS5_MOUSE Ceramide synthase 5 OS=Mus musculus OX=10090 GN=Cers5 PE=1 SV=1
11	PDB:2hi3A	0.115	0.508	4.510E-1	73	0.037	0.192	2hi3A.pdb.gz
12	PDB:7f73A	0.339	0.415	1.024	293	0.066	0.085	7f73A.pdb.gz
13	PDB:7f3tA	0.279	0.310	1.165	330	0.063	0.073	7f3tA.pdb.gz	TMEM120A contains a specific coenzyme A-binding site and might not mediate poking- or stretch-induced channel activities in cells.
14	PDB:7sptA	0.130	0.114	1.326	470	0.092	0.074	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
15	PDB:6awlA	0.094	0.134	2.042	217	0.079	0.138	6awlA.pdb.gz
16	PDB:7lp9A	0.205	0.139	2.132	634	0.092	0.055	7lp9A.pdb.gz	Heat-dependent opening of TRPV1 in the presence of capsaicin.
17	PDB:6c0fz	0.131	0.186	2.226	243	0.076	0.119	6c0fz.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
18	PDB:7nj0C	0.097	0.124	2.226	270	0.084	0.119	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
19	PDB:6g79S	0.120	0.156	2.324	262	0.118	0.172	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
20	PDB:1qoyA	0.128	0.152	2.645	303	0.071	0.089	1qoyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V8V4	0.0	706	380	0.924	0.924	G3V8V4_RAT Ceramide synthase 2 OS=Rattus norvegicus OX=10116 GN=Cers2 PE=1 SV=1
2	Q3T1K1	0.0	634	385	0.803	0.792	Q3T1K1_RAT Ceramide synthase 2 OS=Rattus norvegicus OX=10116 GN=Cers2 PE=1 SV=1
3	Q924Z4	0.0	719	380	0.924	0.924	CERS2_MOUSE Ceramide synthase 2 OS=Mus musculus OX=10090 GN=Cers2 PE=1 SV=1
4	Q96G23	0.0	783	380	1.000	1.000	CERS2_HUMAN Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1
5	E7F9X7	1.72e-176	498	383	0.650	0.645	E7F9X7_DANRE Ceramide synthase 2-like OS=Danio rerio OX=7955 GN=cers2b PE=1 SV=1
6	Q1A3B0	8.67e-135	392	383	0.513	0.509	CERS3_MOUSE Ceramide synthase 3 OS=Mus musculus OX=10090 GN=Cers3 PE=1 SV=1
7	Q8IU89	2.33e-133	388	383	0.526	0.522	CERS3_HUMAN Ceramide synthase 3 OS=Homo sapiens OX=9606 GN=CERS3 PE=1 SV=2
8	Q9HA82	3.75e-120	355	394	0.484	0.467	CERS4_HUMAN Ceramide synthase 4 OS=Homo sapiens OX=9606 GN=CERS4 PE=1 SV=2
9	Q9D6J1	6.02e-115	342	393	0.432	0.417	CERS4_MOUSE Ceramide synthase 4 OS=Mus musculus OX=10090 GN=Cers4 PE=1 SV=1
10	Q6ZMG9	1.68e-101	307	384	0.389	0.385	CERS6_HUMAN Ceramide synthase 6 OS=Homo sapiens OX=9606 GN=CERS6 PE=1 SV=1
11	Q8C172	8.43e-98	298	384	0.384	0.380	CERS6_MOUSE Ceramide synthase 6 OS=Mus musculus OX=10090 GN=Cers6 PE=1 SV=1
12	Q8N5B7	3.23e-97	296	392	0.418	0.406	CERS5_HUMAN Ceramide synthase 5 OS=Homo sapiens OX=9606 GN=CERS5 PE=1 SV=1
13	Q9D6K9	4.09e-93	286	414	0.379	0.348	CERS5_MOUSE Ceramide synthase 5 OS=Mus musculus OX=10090 GN=Cers5 PE=1 SV=1
14	Q9W423	3.08e-87	271	400	0.384	0.365	Q9W423_DROME LD18904p OS=Drosophila melanogaster OX=7227 GN=schlank PE=1 SV=2
15	G5ED45	4.65e-49	171	368	0.305	0.315	HYL1_CAEEL Ceramide synthase hyl-1 OS=Caenorhabditis elegans OX=6239 GN=hyl-1 PE=1 SV=1
16	Q6NQI8	1.48e-38	142	308	0.234	0.289	LOH3_ARATH Ceramide synthase 1 LOH3 OS=Arabidopsis thaliana OX=3702 GN=LOH3 PE=1 SV=2
17	Q9LDF2	4.25e-37	138	310	0.224	0.274	LOH1_ARATH Ceramide synthase LOH1 OS=Arabidopsis thaliana OX=3702 GN=LOH1 PE=1 SV=1
18	Q9LJK3	1.13e-36	136	296	0.208	0.267	LOH2_ARATH Ceramide synthase LOH2 OS=Arabidopsis thaliana OX=3702 GN=LOH2 PE=1 SV=1
19	A0A1D8PKA5	4.11e-29	119	427	0.187	0.166	A0A1D8PKA5_CANAL Lac1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LAC1 PE=3 SV=1
20	Q57V92	6.24e-24	103	397	0.213	0.204	Q57V92_TRYB2 TLC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.260 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	0.034	25.3	Homeodomain
2	PF11569 Homez	2.1e+02	12.9	Homeodomain leucine-zipper encoding, Homez
3	PF03798 TRAM_LAG1_CLN8	6.2e-38	142.0	TLC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012222

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010627	0.993	3-ketodihydrosphingosine reductase
2	61853.ENSNLEP00000016258	0.992	Delta(4)-desaturase, sphingolipid 1
3	61853.ENSNLEP00000001166	0.991	Delta(4)-desaturase, sphingolipid 2
4	61853.ENSNLEP00000019221	0.951	Ceramide kinase
5	61853.ENSNLEP00000014683	0.950	Sphingomyelin synthase 1
6	61853.ENSNLEP00000019953	0.950	UDP-glucose ceramide glucosyltransferase
7	61853.ENSNLEP00000005507	0.939	Sphingosine kinase 2
8	61853.ENSNLEP00000015760	0.938	Sphingomyelin synthase 2
9	61853.ENSNLEP00000011720	0.937	Sphingosine-1-phosphate phosphatase 2
10	61853.ENSNLEP00000002843	0.934	Sphingosine kinase 1
11	61853.ENSNLEP00000020503	0.933	Galactosylceramidase
12	61853.ENSNLEP00000019648	0.930	UDP glycosyltransferase 8
13	61853.ENSNLEP00000014611	0.924	Glucosylceramidase
14	61853.ENSNLEP00000005046	0.923	Non-lysosomal glucosylceramidase
15	61853.ENSNLEP00000009771	0.922	Fatty acid 2-hydroxylase
16	61853.ENSNLEP00000017850	0.914	Uncharacterized protein
17	61853.ENSNLEP00000003728	0.903	N-acylsphingosine amidohydrolase (acid ceramidase) 1
18	61853.ENSNLEP00000021273	0.889	Alkaline ceramidase
19	61853.ENSNLEP00000020403	0.888	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid
20	61853.ENSNLEP00000014662	0.876	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050291	1.000	sphingosine N-acyltransferase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0044255	0.996	cellular lipid metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:0044249	0.995	cellular biosynthetic process
GO:0043603	0.993	amide metabolic process
GO:0006665	0.992	sphingolipid metabolic process
GO:1901566	0.991	organonitrogen compound biosynthetic process
GO:0008610	0.991	lipid biosynthetic process
GO:0044271	0.988	cellular nitrogen compound biosynthetic process
GO:0043604	0.983	amide biosynthetic process
GO:0030148	0.978	sphingolipid biosynthetic process
GO:0006672	0.971	ceramide metabolic process
GO:0046513	0.953	ceramide biosynthetic process
GO:0065007	0.667	biological regulation
GO:0050789	0.620	regulation of biological process
GO:0050794	0.411	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0032991	0.302	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23768	1.000	a fatty acyl-CoA + sphing-4-enine = an N-acylsphing-4-enine + CoA + H(+)
EC:2.3.1.24	1.000	sphingosine N-acyltransferase.

[back to server]