StarFunc result for job id Q96G25

User Input

>input (268 residues)
MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLN
KVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQ
EKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPTDTNA
LVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAPSQQQPMLSGVQ
MAQAGQPGKMPSGIKTNIKSASMHPYQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96G25	1.000	1.000	5.824E-42	268	1.000	1.000	Q96G25.pdb.gz	MED8_HUMAN Mediator of RNA polymerase II transcription subunit 8 OS=Homo sapiens OX=9606 GN=MED8 PE=1 SV=2
2	PDB:7enah	0.558	0.770	1.930E-24	190	0.705	0.995	7enah.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
3	AFDB:A1ZBT5	0.623	0.658	9.828E-21	252	0.444	0.472	A1ZBT5.pdb.gz	MED8_DROME Mediator of RNA polymerase II transcription subunit 8 OS=Drosophila melanogaster OX=7227 GN=MED8 PE=1 SV=1
4	PDB:7lbmh	0.465	0.767	7.502E-18	158	0.582	0.987	7lbmh.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
5	PDB:7nvrb	0.407	0.779	1.978E-14	136	0.504	0.993	7nvrb.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
6	PDB:4h63H	0.406	0.597	7.216E-5	174	0.175	0.270	4h63H.pdb.gz
7	AFDB:Q4V3C1	0.410	0.226	8.870E-5	524	0.179	0.092	Q4V3C1.pdb.gz	MED8_ARATH Mediator of RNA polymerase II transcription subunit 8 OS=Arabidopsis thaliana OX=3702 GN=MED8 PE=1 SV=1
8	AFDB:Q586U8	0.120	0.052	4.858E-3	762	0.131	0.046	Q586U8.pdb.gz	Q586U8_TRYB2 Paraflagellar rod protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.515 PE=4 SV=1
9	AFDB:Q6E2N3	0.178	0.064	6.709E-3	1163	0.157	0.036	Q6E2N3.pdb.gz	TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio OX=7955 GN=trim33 PE=2 SV=1
10	AFDB:F4JR68	0.189	0.123	9.266E-3	443	0.134	0.081	F4JR68.pdb.gz	F4JR68_ARATH Integral membrane metal-binding family protein (DUF2296) OS=Arabidopsis thaliana OX=3702 GN=LNP22 PE=1 SV=1
11	AFDB:Q54PB6	0.178	0.073	1.125E-2	766	0.131	0.046	Q54PB6.pdb.gz	Q54PB6_DICDI B box-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284657 PE=4 SV=1
12	AFDB:Q3ZK22	0.136	0.059	1.456E-2	780	0.160	0.055	Q3ZK22.pdb.gz	VEZA_MOUSE Vezatin OS=Mus musculus OX=10090 GN=Vezt PE=1 SV=2
13	AFDB:Q9BI71	0.138	0.083	1.553E-2	469	0.138	0.079	Q9BI71.pdb.gz	Q9BI71_CAEEL ENTH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epn-1 PE=1 SV=1
14	AFDB:Q45013	0.158	0.069	1.885E-2	700	0.127	0.049	Q45013.pdb.gz	Q45013_BORBU Borrelia P83/P100 antigen OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=p83/100 PE=4 SV=2
15	PDB:6lulA	0.141	0.159	3.787E-2	224	0.134	0.161	6lulA.pdb.gz
16	PDB:4gwpC	0.376	0.515	5.579E-2	184	0.127	0.185	4gwpC.pdb.gz
17	PDB:5n9jB	0.209	0.383	2.463E-1	133	0.093	0.188	5n9jB.pdb.gz
18	PDB:5n9jV	0.203	0.470	2.627E-1	99	0.041	0.111	5n9jV.pdb.gz
19	PDB:7enal	0.159	0.271	2.627E-1	126	0.075	0.159	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:4gwpA	0.136	0.236	5.011E-1	112	0.063	0.152	4gwpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AIE4	0.0	532	268	0.974	0.974	A0A8I6AIE4_RAT Mediator of RNA polymerase II transcription subunit 8 OS=Rattus norvegicus OX=10116 GN=Med8 PE=3 SV=1
2	A0A8I6AU03	0.0	521	356	0.951	0.716	A0A8I6AU03_RAT Mediator of RNA polymerase II transcription subunit 8 OS=Rattus norvegicus OX=10116 GN=Med8 PE=3 SV=1
3	Q96G25	0.0	549	268	1.000	1.000	MED8_HUMAN Mediator of RNA polymerase II transcription subunit 8 OS=Homo sapiens OX=9606 GN=MED8 PE=1 SV=2
4	Q9D7W5	0.0	526	268	0.966	0.966	MED8_MOUSE Mediator of RNA polymerase II transcription subunit 8 OS=Mus musculus OX=10090 GN=Med8 PE=1 SV=1
5	A1ZBT5	2.81e-61	196	252	0.448	0.476	MED8_DROME Mediator of RNA polymerase II transcription subunit 8 OS=Drosophila melanogaster OX=7227 GN=MED8 PE=1 SV=1
6	O94646	0.031	37.0	200	0.127	0.170	MED8_SCHPO Mediator of RNA polymerase II transcription subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med8 PE=1 SV=1
7	P34346	0.46	33.9	251	0.112	0.120	KAD2_CAEEL Adenylate kinase OS=Caenorhabditis elegans OX=6239 GN=let-754 PE=3 SV=2
8	Q80Z25	2.9	32.0	1017	0.104	0.028	OFD1_MOUSE Centriole and centriolar satellite protein OFD1 OS=Mus musculus OX=10090 GN=Ofd1 PE=1 SV=1
9	G4SLH0	3.5	32.0	18562	0.060	0.001	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
10	A0A8I5Y6J8	5.7	31.2	3859	0.049	0.003	A0A8I5Y6J8_RAT Transformation/transcription domain-associated protein OS=Rattus norvegicus OX=10116 GN=Trrap PE=1 SV=1
11	A0A8I6GLC1	5.7	31.2	3874	0.049	0.003	A0A8I6GLC1_RAT Transformation/transcription domain-associated protein OS=Rattus norvegicus OX=10116 GN=Trrap PE=1 SV=1
12	H0Y4W2	5.7	31.2	3873	0.049	0.003	H0Y4W2_HUMAN Transformation/transcription domain associated protein OS=Homo sapiens OX=9606 GN=TRRAP PE=1 SV=2
13	Q9Y4A5	5.7	31.2	3859	0.049	0.003	TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP PE=1 SV=3
14	A0A8I6AL99	5.8	31.2	3873	0.049	0.003	A0A8I6AL99_RAT Transformation/transcription domain-associated protein OS=Rattus norvegicus OX=10116 GN=Trrap PE=1 SV=1
15	A0A0R4ITC5	6.6	30.8	3841	0.049	0.003	TRRAP_DANRE Transformation/transcription domain-associated protein OS=Danio rerio OX=7955 GN=trrap PE=3 SV=1
16	Q762B4	6.9	30.4	627	0.078	0.033	BP103_ORYSJ Proton pump-interactor BIP103 OS=Oryza sativa subsp. japonica OX=39947 GN=BIP103 PE=1 SV=1
17	Q6AW69	7.6	30.4	1297	0.157	0.032	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
18	Q8WXI7	7.7	30.8	14507	0.075	0.001	MUC16_HUMAN Mucin-16 OS=Homo sapiens OX=9606 GN=MUC16 PE=1 SV=3
19	Q9NZM3	9.0	30.4	1697	0.075	0.012	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
20	Q5TZ63	9.4	30.4	1008	0.063	0.017	Q5TZ63_DANRE EMILIN-1 precursor OS=Danio rerio OX=7955 GN=im:7159005 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	15	17.1	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF13094 CENP-Q	6.9e+02	11.8	CENP-Q, a CENPA-CAD centromere complex subunit
3	PF18420 CSN4_RPN5_eIF3a	1.8e+02	13.7	CSN4/RPN5/eIF3a helix turn helix domain
4	PF10232 Med8	7.2e-87	302.4	Mediator of RNA polymerase II transcription complex subunit 8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251871	0.999	Mediator of RNA polymerase II transcription subunit 17
2	9606.ENSP00000293777	0.999	Mediator of RNA polymerase II transcription subunit 11
3	9606.ENSP00000362948	0.999	Mediator of RNA polymerase II transcription subunit 18
4	9606.ENSP00000481920	0.999	Mediator of RNA polymerase II transcription subunit 6
5	9606.ENSP00000323720	0.998	Mediator of RNA polymerase II transcription subunit 14
6	9606.ENSP00000258648	0.997	Mediator of RNA polymerase II transcription subunit 4
7	9606.ENSP00000314343	0.997	Mediator of RNA polymerase II transcription subunit 29
8	9606.ENSP00000265350	0.996	Mediator of RNA polymerase II transcription subunit 20
9	9606.ENSP00000286317	0.996	Mediator of RNA polymerase II transcription subunit 7
10	9606.ENSP00000325612	0.996	Mediator of RNA polymerase II transcription subunit 16
11	9606.ENSP00000370938	0.996	Cyclin-dependent kinase 8
12	9606.ENSP00000255764	0.995	Mediator of RNA polymerase II transcription subunit 10
13	9606.ENSP00000282892	0.995	Mediator of RNA polymerase II transcription subunit 21
14	9606.ENSP00000337340	0.995	Mediator of RNA polymerase II transcription subunit 19
15	9606.ENSP00000300651	0.994	Mediator of RNA polymerase II transcription subunit 1
16	9606.ENSP00000363193	0.994	Mediator of RNA polymerase II transcription subunit 12
17	9606.ENSP00000297347	0.993	Mediator of RNA polymerase II transcription subunit 30
18	9606.ENSP00000380888	0.993	Mediator of RNA polymerase II transcription subunit 13
19	9606.ENSP00000482438	0.992	Mediator of RNA polymerase II transcription subunit 22
20	9606.ENSP00000263205	0.990	Mediator of RNA polymerase II transcription subunit 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.681	catalytic activity
GO:0140096	0.476	catalytic activity, acting on a protein
GO:0019787	0.361	ubiquitin-like protein transferase activity
GO:0004842	0.331	ubiquitin-protein transferase activity
GO:0061630	0.322	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070647	0.996	protein modification by small protein conjugation or removal
GO:0016567	0.965	protein ubiquitination
GO:0050794	0.807	regulation of cellular process
GO:0019222	0.709	regulation of metabolic process
GO:0019219	0.673	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.668	regulation of macromolecule metabolic process
GO:0010468	0.664	regulation of gene expression
GO:0009987	0.651	cellular process
GO:0051252	0.635	regulation of RNA metabolic process
GO:2001141	0.626	regulation of RNA biosynthetic process
GO:0006355	0.623	regulation of DNA-templated transcription
GO:0006357	0.569	regulation of transcription by RNA polymerase II
GO:0048518	0.366	positive regulation of biological process
GO:0048522	0.357	positive regulation of cellular process
GO:0009893	0.348	positive regulation of metabolic process
GO:0010604	0.321	positive regulation of macromolecule metabolic process
GO:0044237	0.303	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0140513	0.951	nuclear protein-containing complex
GO:0070847	0.935	core mediator complex
GO:0016592	0.933	mediator complex
GO:0140535	0.554	intracellular protein-containing complex
GO:1902494	0.535	catalytic complex
GO:1990234	0.529	transferase complex
GO:0005829	0.400	cytosol
GO:0043232	0.318	intracellular non-membrane-bounded organelle
GO:0000151	0.312	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.364	Transferases.

[back to server]