StarFunc result for job id Q96G27

User Input

>input (269 residues)
MARASSGNGSEEAWGALRAPQQQLRELCPGVNNQPYLCESGHCCGETGCCTYYYELWWFW
LLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPFPTGSLLDLRFLS
TFKPPAYEDVVHRPGTPPPPYTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQ
SAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDL
EDYSPCALPPESVPQIFPMGLSSSEGDIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96G27	1.000	1.000	2.346E-44	269	1.000	1.000	Q96G27.pdb.gz	WBP1_HUMAN WW domain-binding protein 1 OS=Homo sapiens OX=9606 GN=WBP1 PE=1 SV=1
2	AFDB:Q9NX94	0.247	0.204	4.833E-13	342	0.383	0.301	Q9NX94.pdb.gz	WBP1L_HUMAN WW domain binding protein 1-like OS=Homo sapiens OX=9606 GN=WBP1L PE=1 SV=2
3	AFDB:Q8BGW2	0.251	0.201	8.226E-12	348	0.349	0.270	Q8BGW2.pdb.gz	WBP1L_MOUSE WW domain binding protein 1-like OS=Mus musculus OX=10090 GN=Wbp1l PE=2 SV=1
4	AFDB:Q9DG15	0.186	0.079	3.331E-2	740	0.164	0.059	Q9DG15.pdb.gz	Q9DG15_CHICK p95-APP1 OS=Gallus gallus OX=9031 PE=2 SV=1
5	AFDB:Q96K80	0.175	0.117	3.569E-2	434	0.149	0.092	Q96K80.pdb.gz	ZC3HA_HUMAN Zinc finger CCCH domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZC3H10 PE=1 SV=1
6	AFDB:A0A0C4DGN6	0.204	0.079	1.079E-1	747	0.167	0.060	A0A0C4DGN6.pdb.gz	A0A0C4DGN6_HUMAN GIT ArfGAP 1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=1
7	AFDB:Q86XD5	0.124	0.104	1.750E-1	332	0.175	0.142	Q86XD5.pdb.gz	F131B_HUMAN Protein FAM131B OS=Homo sapiens OX=9606 GN=FAM131B PE=1 SV=3
8	AFDB:Q17308	0.179	0.043	2.650E-1	1165	0.175	0.040	Q17308.pdb.gz	TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae OX=6238 GN=tra-1 PE=1 SV=1
9	AFDB:A2BG45	0.165	0.072	3.043E-1	750	0.160	0.057	A2BG45.pdb.gz	A2BG45_DANRE ARF GTPase-activating protein GIT2 OS=Danio rerio OX=7955 GN=git2 PE=4 SV=1
10	AFDB:A0A0B4K6P4	0.169	0.061	4.012E-1	799	0.152	0.051	A0A0B4K6P4.pdb.gz	A0A0B4K6P4_DROME Hephaestus, isoform W OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
11	PDB:7s78R	0.135	0.331	8.140	101	0.045	0.119	7s78R.pdb.gz	Structure of a Cell Entry Defective Human Adenovirus Provides Insights into Precursor Proteins and Capsid Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96G27	0.0	546	269	1.000	1.000	WBP1_HUMAN WW domain-binding protein 1 OS=Homo sapiens OX=9606 GN=WBP1 PE=1 SV=1
2	P97764	5.04e-146	412	304	0.844	0.747	WBP1_MOUSE WW domain-binding protein 1 OS=Mus musculus OX=10090 GN=Wbp1 PE=1 SV=2
3	Q8BGW2	1.07e-42	150	348	0.387	0.299	WBP1L_MOUSE WW domain binding protein 1-like OS=Mus musculus OX=10090 GN=Wbp1l PE=2 SV=1
4	Q9NX94	6.68e-41	145	342	0.372	0.292	WBP1L_HUMAN WW domain binding protein 1-like OS=Homo sapiens OX=9606 GN=WBP1L PE=1 SV=2
5	P0C6T3	0.001	42.0	269	0.071	0.071	PRR7_RAT Proline-rich protein 7 OS=Rattus norvegicus OX=10116 GN=Prr7 PE=1 SV=1
6	Q3V0I2	0.001	41.6	269	0.071	0.071	PRR7_MOUSE Proline-rich protein 7 OS=Mus musculus OX=10090 GN=Prr7 PE=1 SV=1
7	Q8TB68	0.001	42.0	274	0.071	0.069	PRR7_HUMAN Proline-rich protein 7 OS=Homo sapiens OX=9606 GN=PRR7 PE=1 SV=1
8	Q96AW1	0.21	34.3	172	0.063	0.099	VOPP1_HUMAN WW domain binding protein VOPP1 OS=Homo sapiens OX=9606 GN=VOPP1 PE=1 SV=1
9	E9PWQ3	0.36	35.0	3284	0.112	0.009	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
10	A0A087WS16	0.55	34.3	2677	0.112	0.011	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
11	P12111	0.95	33.5	3177	0.100	0.008	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
12	A0A8I6AHL9	1.2	33.1	3316	0.108	0.009	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
13	A0A8I5ZTR6	1.5	33.1	3109	0.108	0.009	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
14	Q99JE4	1.9	32.3	1190	0.056	0.013	RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus OX=10116 GN=Rasgrf2 PE=1 SV=1
15	Q38CF6	3.0	32.0	1719	0.059	0.009	Q38CF6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7320 PE=4 SV=1
16	Q385P2	4.3	31.2	968	0.086	0.024	Q385P2_TRYB2 SNF2 DNA repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2930 PE=4 SV=1
17	C6KSK8	4.5	31.6	2879	0.078	0.007	C6KSK8_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0600200 PE=4 SV=1
18	O35627	4.8	30.8	358	0.089	0.067	NR1I3_MOUSE Nuclear receptor subfamily 1 group I member 3 OS=Mus musculus OX=10090 GN=Nr1i3 PE=1 SV=2
19	Q582H5	5.5	31.2	1026	0.093	0.024	Q582H5_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.410 PE=4 SV=1
20	Q389Q3	6.5	30.8	1570	0.067	0.011	Q389Q3_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0130 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05083 LST1	1.1e+02	14.5	LST-1 protein
2	PF11669 WBP-1	2.4e-39	145.7	WW domain-binding protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233615

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467579	0.947	WW domain-binding protein 2
2	9606.ENSP00000285279	0.729	Vesicular, overexpressed in cancer, prosurvival protein 1
3	9606.ENSP00000478927	0.708	Transcriptional coactivator YAP1
4	9606.ENSP00000299340	0.703	Cysteine and tyrosine rich 1
5	9606.ENSP00000390084	0.699	Protein shisa-6 homolog
6	9606.ENSP00000326445	0.696	Protein shisa-3 homolog
7	9606.ENSP00000412698	0.665	MMS19 nucleotide excision repair protein homolog
8	9606.ENSP00000355064	0.663	Protein shisa-4
9	9606.ENSP00000424827	0.634	E3 ubiquitin-protein ligase NEDD4
10	9606.ENSP00000298569	0.631	Putative monooxygenase p33MONOX
11	9606.ENSP00000457230	0.605	WW domain-containing oxidoreductase
12	9606.ENSP00000370568	0.592	Uncharacterized protein KIAA1644
13	9606.ENSP00000346981	0.533	Transmembrane protein 207

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050699	1.000	WW domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0048856	0.977	anatomical structure development
GO:0048518	0.976	positive regulation of biological process
GO:0051716	0.967	cellular response to stimulus
GO:0019222	0.949	regulation of metabolic process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0051171	0.904	regulation of nitrogen compound metabolic process
GO:0080090	0.899	regulation of primary metabolic process
GO:0010604	0.893	positive regulation of macromolecule metabolic process
GO:0051173	0.856	positive regulation of nitrogen compound metabolic process
GO:0007154	0.830	cell communication
GO:0023052	0.829	signaling
GO:0042221	0.819	response to chemical
GO:0010033	0.806	response to organic substance
GO:0007165	0.769	signal transduction
GO:0030154	0.719	cell differentiation
GO:0071310	0.672	cellular response to organic substance
GO:0051247	0.655	positive regulation of protein metabolic process
GO:0048519	0.547	negative regulation of biological process
GO:0048468	0.544	cell development
GO:0048583	0.523	regulation of response to stimulus
GO:0048523	0.498	negative regulation of cellular process
GO:0031399	0.391	regulation of protein modification process
GO:0009966	0.366	regulation of signal transduction
GO:0031401	0.340	positive regulation of protein modification process
GO:0034097	0.331	response to cytokine
GO:0071345	0.320	cellular response to cytokine stimulus
GO:0032501	0.317	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005886	0.994	plasma membrane
GO:0005737	0.989	cytoplasm
GO:0005829	0.945	cytosol
GO:0005634	0.763	nucleus
GO:0070013	0.569	intracellular organelle lumen
GO:0031981	0.550	nuclear lumen
GO:0005654	0.530	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]