StarFunc result for job id Q96G30

User Input

>input (205 residues)
MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFM
FFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYI
NEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGED
DLLISEPPIVLETKPLSQTSHKDLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96G30	0.999	0.999	2.628E-31	205	1.000	1.000	Q96G30.pdb.gz	MRAP2_HUMAN Melanocortin-2 receptor accessory protein 2 OS=Homo sapiens OX=9606 GN=MRAP2 PE=1 SV=2
2	AFDB:D3Z1Q2	0.524	0.520	6.801E-27	207	0.878	0.870	D3Z1Q2.pdb.gz	MRAP2_MOUSE Melanocortin-2 receptor accessory protein 2 OS=Mus musculus OX=10090 GN=Mrap2 PE=1 SV=2
3	AFDB:F8W4H9	0.360	0.343	6.413E-13	217	0.502	0.475	F8W4H9.pdb.gz	MRP2A_DANRE Melanocortin-2 receptor accessory protein 2A OS=Danio rerio OX=7955 GN=mrap2a PE=1 SV=1
4	AFDB:P0DM64	0.290	0.298	1.962E-9	199	0.420	0.432	P0DM64.pdb.gz	MRP2B_DANRE Melanocortin-2 receptor accessory protein 2B OS=Danio rerio OX=7955 GN=mrap2b PE=1 SV=1
5	AFDB:Q9SIB4	0.159	0.138	1.341E-1	244	0.127	0.107	Q9SIB4.pdb.gz	WOX3_ARATH WUSCHEL-related homeobox 3 OS=Arabidopsis thaliana OX=3702 GN=WOX3 PE=1 SV=1
6	AFDB:Q9D2J4	0.151	0.086	2.245E-1	407	0.127	0.064	Q9D2J4.pdb.gz	VSIG1_MOUSE V-set and immunoglobulin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Vsig1 PE=1 SV=1
7	AFDB:Q9ULH4	0.210	0.068	3.014E-1	789	0.161	0.042	Q9ULH4.pdb.gz	LRFN2_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRFN2 PE=1 SV=2
8	AFDB:A6NNM8	0.120	0.045	4.046E-1	815	0.146	0.037	A6NNM8.pdb.gz	TTL13_HUMAN Tubulin polyglutamylase TTLL13 OS=Homo sapiens OX=9606 GN=TTLL13 PE=1 SV=2
9	AFDB:Q7ZYZ9	0.162	0.044	4.688E-1	843	0.127	0.031	Q7ZYZ9.pdb.gz	Q7ZYZ9_DANRE A disintegrin and metalloproteinase domain 8a OS=Danio rerio OX=7955 GN=adam8 PE=2 SV=2
10	AFDB:A5PK42	0.201	0.073	5.046E-1	683	0.171	0.051	A5PK42.pdb.gz	ODAD4_BOVIN Outer dynein arm-docking complex subunit 4 OS=Bos taurus OX=9913 GN=ODAD4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96G30	5.10e-155	429	205	1.000	1.000	MRAP2_HUMAN Melanocortin-2 receptor accessory protein 2 OS=Homo sapiens OX=9606 GN=MRAP2 PE=1 SV=2
2	D3Z1Q2	9.24e-135	377	207	0.878	0.870	MRAP2_MOUSE Melanocortin-2 receptor accessory protein 2 OS=Mus musculus OX=10090 GN=Mrap2 PE=1 SV=2
3	F8W4H9	2.24e-56	179	217	0.522	0.493	MRP2A_DANRE Melanocortin-2 receptor accessory protein 2A OS=Danio rerio OX=7955 GN=mrap2a PE=1 SV=1
4	P0DM64	2.91e-43	145	199	0.415	0.427	MRP2B_DANRE Melanocortin-2 receptor accessory protein 2B OS=Danio rerio OX=7955 GN=mrap2b PE=1 SV=1
5	Q9D159	0.003	38.5	127	0.132	0.213	MRAP_MOUSE Melanocortin-2 receptor accessory protein OS=Mus musculus OX=10090 GN=Mrap PE=1 SV=1
6	Q8TCY5	0.006	38.1	172	0.107	0.128	MRAP_HUMAN Melanocortin-2 receptor accessory protein OS=Homo sapiens OX=9606 GN=MRAP PE=1 SV=2
7	A0A1B0GV47	1.8	32.0	1653	0.098	0.012	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
8	Q7Z4S6	1.8	32.0	1674	0.098	0.012	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
9	Q9LK83	5.9	30.4	1156	0.093	0.016	Q9LK83_ARATH Portal protein OS=Arabidopsis thaliana OX=3702 GN=RASD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15183 MRAP	2.5e-33	125.2	Melanocortin-2 receptor accessory protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333821	0.956	Adrenocorticotropic hormone receptor
2	9606.ENSP00000299766	0.932	Melanocortin receptor 4
3	9606.ENSP00000318077	0.909	Melanocortin receptor 5
4	9606.ENSP00000243911	0.889	Melanocortin receptor 3
5	9606.ENSP00000358695	0.732	Cytochrome b5 reductase 4
6	9606.ENSP00000451605	0.732	Melanocyte-stimulating hormone receptor
7	9606.ENSP00000253329	0.727	Peptidyl-prolyl cis-trans isomerase-like 4
8	9606.ENSP00000384092	0.682	Pro-opiomelanocortin
9	9606.ENSP00000290953	0.630	Agouti-related protein
10	9606.ENSP00000358703	0.630	Protein ripply2
11	9606.ENSP00000382684	0.623	Melanocortin-2 receptor accessory protein
12	9606.ENSP00000265085	0.613	Cytoplasmic polyadenylation element-binding protein 4
13	9606.ENSP00000303775	0.564	Prokineticin receptor 1
14	9606.ENSP00000358210	0.563	Single-minded homolog 1
15	9606.ENSP00000454804	0.559	Agouti-signaling protein
16	9606.ENSP00000266771	0.547	Solute carrier family 15 member 4
17	9606.ENSP00000255977	0.545	E3 ubiquitin-protein ligase makorin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031782	1.000	type 4 melanocortin receptor binding
GO:0042802	0.996	identical protein binding
GO:0070996	0.709	type 1 melanocortin receptor binding
GO:0031781	0.709	type 3 melanocortin receptor binding
GO:0031783	0.696	type 5 melanocortin receptor binding
GO:0031780	0.696	corticotropin hormone receptor binding
GO:0098772	0.375	molecular function regulator activity
GO:0030545	0.367	signaling receptor regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.947	positive regulation of biological process
GO:0051179	0.944	localization
GO:0048583	0.942	regulation of response to stimulus
GO:0048522	0.930	positive regulation of cellular process
GO:0048519	0.923	negative regulation of biological process
GO:0023051	0.911	regulation of signaling
GO:0010646	0.911	regulation of cell communication
GO:0008277	0.841	regulation of G protein-coupled receptor signaling pathway
GO:0051668	0.815	localization within membrane
GO:0048584	0.800	positive regulation of response to stimulus
GO:0009967	0.789	positive regulation of signal transduction
GO:0048523	0.782	negative regulation of cellular process
GO:1990778	0.750	protein localization to cell periphery
GO:0106070	0.749	regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0045745	0.737	positive regulation of G protein-coupled receptor signaling pathway
GO:0008152	0.717	metabolic process
GO:0072657	0.717	protein localization to membrane
GO:0032501	0.715	multicellular organismal process
GO:0010648	0.708	negative regulation of cell communication
GO:0032880	0.689	regulation of protein localization
GO:1905475	0.662	regulation of protein localization to membrane
GO:0023057	0.653	negative regulation of signaling
GO:1903828	0.652	negative regulation of protein localization
GO:0009968	0.640	negative regulation of signal transduction
GO:1903076	0.605	regulation of protein localization to plasma membrane
GO:0044237	0.578	cellular metabolic process
GO:0072659	0.525	protein localization to plasma membrane
GO:0045744	0.494	negative regulation of G protein-coupled receptor signaling pathway
GO:0050896	0.472	response to stimulus
GO:0007631	0.373	feeding behavior
GO:0006091	0.352	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005783	1.000	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]