StarFunc result for job id Q96G91

User Input

>input (374 residues)
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP
WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI
TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC
SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV
AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY
VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA
APKPSEPQSRELSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96G91	1.000	1.000	9.485E-51	374	1.000	1.000	Q96G91.pdb.gz	P2Y11_HUMAN P2Y purinoceptor 11 OS=Homo sapiens OX=9606 GN=P2RY11 PE=2 SV=2
2	AFDB:Q2PBC2	0.708	0.839	5.253E-18	313	0.329	0.393	Q2PBC2.pdb.gz	Q2PBC2_XENLA G-protein coupled receptor OS=Xenopus laevis OX=8355 GN=p2ry11.L PE=2 SV=1
3	AFDB:P47900	0.695	0.697	3.244E-15	373	0.270	0.271	P47900.pdb.gz	P2RY1_HUMAN P2Y purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RY1 PE=1 SV=1
4	AFDB:O35811	0.683	0.706	1.516E-14	361	0.265	0.274	O35811.pdb.gz	P2RY4_RAT P2Y purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2ry4 PE=2 SV=1
5	AFDB:P41232	0.668	0.668	1.583E-14	374	0.249	0.249	P41232.pdb.gz	P2RY2_RAT P2Y purinoceptor 2 OS=Rattus norvegicus OX=10116 GN=P2ry2 PE=2 SV=2
6	AFDB:P41231	0.665	0.660	3.278E-14	377	0.243	0.241	P41231.pdb.gz	P2RY2_HUMAN P2Y purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RY2 PE=1 SV=4
7	AFDB:P51582	0.686	0.702	3.278E-14	365	0.273	0.279	P51582.pdb.gz	P2RY4_HUMAN P2Y purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RY4 PE=1 SV=1
8	AFDB:Q63371	0.682	0.771	5.482E-14	328	0.219	0.250	Q63371.pdb.gz	P2RY6_RAT P2Y purinoceptor 6 OS=Rattus norvegicus OX=10116 GN=P2ry6 PE=2 SV=1
9	AFDB:B2R986	0.687	0.758	1.899E-13	337	0.198	0.220	B2R986.pdb.gz	B2R986_HUMAN HCG1774561 OS=Homo sapiens OX=9606 GN=hCG_1774561 PE=2 SV=1
10	AFDB:A2BIP6	0.680	0.619	2.914E-13	413	0.230	0.208	A2BIP6.pdb.gz	A2BIP6_DANRE Proteinase-activated receptor 1 OS=Danio rerio OX=7955 GN=PAR1 PE=2 SV=1
11	PDB:7vl9R	0.670	0.821	6.974E-12	302	0.190	0.235	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
12	PDB:7f1qR	0.645	0.656	1.950E-11	367	0.168	0.172	7f1qR.pdb.gz
13	PDB:7w56R	0.620	0.822	4.216E-11	276	0.184	0.250	7w56R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
14	PDB:7wq3R	0.627	0.800	4.216E-11	289	0.166	0.215	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
15	PDB:7vktA	0.635	0.814	5.939E-11	287	0.182	0.237	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
16	PDB:7f6hA	0.618	0.742	1.733E-10	305	0.166	0.203	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
17	PDB:6ibbA	0.616	0.754	1.888E-10	301	0.203	0.252	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
18	PDB:4xesA	0.634	0.512	1.971E-10	471	0.179	0.142	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
19	PDB:7w55R	0.614	0.746	2.776E-10	303	0.174	0.215	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
20	PDB:7x9yR	0.616	0.774	2.776E-10	293	0.176	0.225	7x9yR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96G91	0.0	755	374	1.000	1.000	P2Y11_HUMAN P2Y purinoceptor 11 OS=Homo sapiens OX=9606 GN=P2RY11 PE=2 SV=2
2	Q2PBC2	2.58e-68	219	313	0.361	0.431	Q2PBC2_XENLA G-protein coupled receptor OS=Xenopus laevis OX=8355 GN=p2ry11.L PE=2 SV=1
3	P59902	4.65e-46	163	373	0.267	0.268	P2RY1_CAVPO P2Y purinoceptor 1 OS=Cavia porcellus OX=10141 GN=P2RY1 PE=2 SV=1
4	P47900	1.71e-45	162	373	0.262	0.263	P2RY1_HUMAN P2Y purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RY1 PE=1 SV=1
5	P49651	2.36e-45	161	373	0.259	0.260	P2RY1_RAT P2Y purinoceptor 1 OS=Rattus norvegicus OX=10116 GN=P2ry1 PE=2 SV=1
6	P49650	5.70e-45	160	373	0.257	0.257	P2RY1_MOUSE P2Y purinoceptor 1 OS=Mus musculus OX=10090 GN=P2ry1 PE=2 SV=1
7	P51582	1.83e-31	124	365	0.259	0.266	P2RY4_HUMAN P2Y purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RY4 PE=1 SV=1
8	O35811	1.75e-30	121	361	0.262	0.271	P2RY4_RAT P2Y purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2ry4 PE=2 SV=1
9	Q13304	3.52e-29	118	367	0.222	0.226	GPR17_HUMAN Uracil nucleotide/cysteinyl leukotriene receptor OS=Homo sapiens OX=9606 GN=GPR17 PE=1 SV=2
10	Q9JJS7	4.88e-29	117	361	0.254	0.263	P2RY4_MOUSE P2Y purinoceptor 4 OS=Mus musculus OX=10090 GN=P2ry4 PE=2 SV=1
11	Q09QM4	3.85e-28	114	339	0.214	0.236	GPR17_RAT Uracil nucleotide/cysteinyl leukotriene receptor OS=Rattus norvegicus OX=10116 GN=Gpr17 PE=2 SV=1
12	Q6NS65	3.97e-28	114	339	0.214	0.236	GPR17_MOUSE Uracil nucleotide/cysteinyl leukotriene receptor OS=Mus musculus OX=10090 GN=Gpr17 PE=1 SV=1
13	P41231	1.37e-24	105	377	0.249	0.247	P2RY2_HUMAN P2Y purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RY2 PE=1 SV=4
14	B2R986	3.45e-22	98.2	337	0.190	0.211	B2R986_HUMAN HCG1774561 OS=Homo sapiens OX=9606 GN=hCG_1774561 PE=2 SV=1
15	Q96P68	3.45e-22	98.2	337	0.190	0.211	OXGR1_HUMAN 2-oxoglutarate receptor 1 OS=Homo sapiens OX=9606 GN=OXGR1 PE=2 SV=1
16	Q9JHG3	4.28e-21	95.5	377	0.190	0.188	APJ_RAT Apelin receptor OS=Rattus norvegicus OX=10116 GN=Aplnr PE=2 SV=1
17	P41232	4.88e-21	95.5	374	0.249	0.249	P2RY2_RAT P2Y purinoceptor 2 OS=Rattus norvegicus OX=10116 GN=P2ry2 PE=2 SV=2
18	Q08BG4	1.32e-20	94.0	357	0.187	0.196	Q08BG4_DANRE Lysophosphatidic acid receptor 6 OS=Danio rerio OX=7955 GN=zgc:153784 PE=1 SV=1
19	Q9ERK9	1.37e-20	93.6	328	0.222	0.253	P2RY6_MOUSE P2Y purinoceptor 6 OS=Mus musculus OX=10090 GN=P2ry6 PE=2 SV=1
20	Q63645	1.39e-20	94.4	397	0.211	0.199	PAR2_RAT Proteinase-activated receptor 2 OS=Rattus norvegicus OX=10116 GN=F2rl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	8.5e-28	108.9	7 transmembrane receptor (rhodopsin family)
2	PF10323 7TM_GPCR_Srv	1.7e+02	13.0	Serpentine type 7TM GPCR chemoreceptor Srv

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377385

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407323	0.969	Probable rRNA-processing protein EBP2
2	9606.ENSP00000346725	0.960	Pescadillo homolog
3	9606.ENSP00000223073	0.956	RNA-binding protein 28
4	9606.ENSP00000359688	0.950	Ribosome production factor 1
5	9606.ENSP00000355899	0.945	RRP15-like protein
6	9606.ENSP00000361092	0.945	Surfeit locus protein 6
7	9606.ENSP00000483495	0.944	Probable ATP-dependent RNA helicase DDX27
8	9606.ENSP00000460871	0.943	Ribosomal L1 domain-containing protein 1
9	9606.ENSP00000432119	0.936	WD repeat-containing protein 74
10	9606.ENSP00000285814	0.935	Nucleolar protein interacting with the FHA domain of MKI67
11	9606.ENSP00000446184	0.930	RRP12-like protein
12	9606.ENSP00000353246	0.928	Protein MAK16 homolog
13	9606.ENSP00000364320	0.914	mRNA turnover protein 4 homolog
14	9606.ENSP00000386226	0.912	RNA-binding protein 34
15	9606.ENSP00000358563	0.905	H/ACA ribonucleoprotein complex subunit 4
16	9606.ENSP00000259239	0.897	U3 small nucleolar ribonucleoprotein protein IMP4
17	9606.ENSP00000238146	0.894	ATP-dependent RNA helicase DDX55
18	9606.ENSP00000402338	0.893	Ribosome production factor 2 homolog
19	9606.ENSP00000354040	0.888	Nucleolar GTP-binding protein 1
20	9606.ENSP00000481495	0.888	ATP-dependent RNA helicase DDX24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0001614	0.992	purinergic nucleotide receptor activity
GO:0030594	0.991	neurotransmitter receptor activity
GO:0005488	0.990	binding
GO:0008528	0.941	G protein-coupled peptide receptor activity
GO:0005515	0.889	protein binding
GO:0097159	0.323	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0051716	0.984	cellular response to stimulus
GO:0023052	0.983	signaling
GO:0007154	0.983	cell communication
GO:0050794	0.981	regulation of cellular process
GO:0007186	0.966	G protein-coupled receptor signaling pathway
GO:0051339	0.735	regulation of lyase activity
GO:0031279	0.735	regulation of cyclase activity
GO:0014070	0.711	response to organic cyclic compound
GO:0010243	0.704	response to organonitrogen compound
GO:0046683	0.667	response to organophosphorus
GO:0045761	0.650	regulation of adenylate cyclase activity
GO:0019932	0.646	second-messenger-mediated signaling
GO:0014074	0.644	response to purine-containing compound
GO:0019722	0.623	calcium-mediated signaling
GO:0031281	0.616	positive regulation of cyclase activity
GO:0051349	0.576	positive regulation of lyase activity
GO:1902074	0.554	response to salt
GO:0007200	0.546	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0009719	0.435	response to endogenous stimulus
GO:0071310	0.398	cellular response to organic substance
GO:1901700	0.336	response to oxygen-containing compound
GO:0071495	0.309	cellular response to endogenous stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.995	cell periphery
GO:0005886	0.987	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]