StarFunc result for job id Q96GA7

User Input

>input (329 residues)
MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMA
KKGCRHLVCSSGGNAGIAAAYAARKLGIPATIVLPESTSLQVVQRLQGEGAEVQLTGKVW
DEANLRAQELAKRDGWENVPPFDHPLIWKGHASLVQELKAVLRTPPGALVLAVGGGGLLA
GVVAGLLEVGWQHVPIIAMETHGAHCFNAAITAGKLVTLPDITSVAKSLGAKTVAARALE
CMQVCKIHSEVVEDTEAVSAVQQLLDDERMLVEPACGAALAAIYSGLLRRLQAEGCLPPS
LTSVVVIVCGGNNINSRELQALKTHLGQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96GA7	1.000	1.000	1.206E-66	329	1.000	1.000	Q96GA7.pdb.gz	SDSL_HUMAN Serine dehydratase-like OS=Homo sapiens OX=9606 GN=SDSL PE=1 SV=1
2	PDB:2rkbA	0.958	0.991	2.059E-58	318	0.967	1.000	2rkbA.pdb.gz	A catalytic mechanism that explains a low catalytic activity of serine dehydratase like-1 from human cancer cells: Crystal structure and site-directed mutagenesis studies.
3	AFDB:Q8R238	0.991	0.991	4.896E-57	329	0.805	0.805	Q8R238.pdb.gz	SDSL_MOUSE Serine dehydratase-like OS=Mus musculus OX=10090 GN=Sdsl PE=1 SV=1
4	AFDB:P20132	0.959	0.962	3.414E-46	328	0.596	0.598	P20132.pdb.gz	SDHL_HUMAN L-serine dehydratase/L-threonine deaminase OS=Homo sapiens OX=9606 GN=SDS PE=1 SV=2
5	AFDB:P09367	0.949	0.860	1.301E-44	363	0.602	0.545	P09367.pdb.gz	SDHL_RAT L-serine dehydratase/L-threonine deaminase OS=Rattus norvegicus OX=10116 GN=Sds PE=1 SV=3
6	PDB:1p5jA	0.955	0.985	5.801E-44	319	0.587	0.605	1p5jA.pdb.gz	Crystallization and preliminary crystallographic analysis of human serine dehydratase.
7	PDB:1pwhA	0.934	0.939	2.621E-42	327	0.596	0.599	1pwhA.pdb.gz	Crystal structure of serine dehydratase from rat liver.
8	AFDB:P25379	0.883	0.810	7.673E-30	360	0.340	0.311	P25379.pdb.gz	STDH_YEAST Catabolic L-serine/threonine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHA1 PE=1 SV=2
9	AFDB:A0A1D8PGA8	0.900	0.841	2.533E-29	353	0.316	0.295	A0A1D8PGA8.pdb.gz	A0A1D8PGA8_CANAL Cha1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHA1 PE=4 SV=1
10	AFDB:P04968	0.843	0.549	3.676E-26	514	0.283	0.181	P04968.pdb.gz	ILVA_ECOLI L-threonine dehydratase biosynthetic IlvA OS=Escherichia coli (strain K12) OX=83333 GN=ilvA PE=1 SV=1
11	AFDB:A0FKE6	0.861	0.478	8.149E-26	606	0.283	0.153	A0FKE6.pdb.gz	TD1_SOLLC Threonine dehydratase 1 biosynthetic, chloroplastic OS=Solanum lycopersicum OX=4081 GN=TD1 PE=1 SV=1
12	AFDB:P00927	0.860	0.501	9.666E-26	576	0.286	0.163	P00927.pdb.gz	THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ILV1 PE=1 SV=2
13	AFDB:P9WG95	0.862	0.668	6.315E-25	429	0.289	0.221	P9WG95.pdb.gz	ILVA_MYCTU L-threonine dehydratase biosynthetic IlvA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ilvA PE=1 SV=1
14	PDB:1tdjA	0.850	0.576	6.997E-24	494	0.286	0.190	1tdjA.pdb.gz	Structure and control of pyridoxal phosphate dependent allosteric threonine deaminase.
15	PDB:7nbcAAA	0.830	0.845	6.255E-22	323	0.246	0.251	7nbcAAA.pdb.gz	Tyrosine 121 moves revealing a ligandable pocket that couples catalysis to ATP-binding in serine racemase.
16	PDB:6lutA	0.818	0.874	7.419E-22	307	0.228	0.244	6lutA.pdb.gz
17	PDB:2d1fA	0.781	0.739	1.468E-21	349	0.240	0.226	2d1fA.pdb.gz	Structural, biochemical, and in vivo investigations of the threonine synthase from Mycobacterium tuberculosis.
18	PDB:2zpuA	0.828	0.853	3.352E-20	319	0.240	0.248	2zpuA.pdb.gz	Serine racemase with catalytically active lysinoalanyl residue.
19	PDB:4d9gB	0.785	0.669	1.473E-17	392	0.213	0.179	4d9gB.pdb.gz
20	PDB:5j43E	0.787	0.822	5.008E-16	314	0.225	0.236	5j43E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96GA7	0.0	663	329	1.000	1.000	SDSL_HUMAN Serine dehydratase-like OS=Homo sapiens OX=9606 GN=SDSL PE=1 SV=1
2	Q8R238	4.39e-180	502	329	0.805	0.805	SDSL_MOUSE Serine dehydratase-like OS=Mus musculus OX=10090 GN=Sdsl PE=1 SV=1
3	P09367	3.69e-118	347	363	0.602	0.545	SDHL_RAT L-serine dehydratase/L-threonine deaminase OS=Rattus norvegicus OX=10116 GN=Sds PE=1 SV=3
4	P20132	1.69e-117	344	328	0.596	0.598	SDHL_HUMAN L-serine dehydratase/L-threonine deaminase OS=Homo sapiens OX=9606 GN=SDS PE=1 SV=2
5	P25379	3.88e-56	188	360	0.350	0.319	STDH_YEAST Catabolic L-serine/threonine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHA1 PE=1 SV=2
6	F8VXS0	5.38e-43	150	235	0.258	0.362	F8VXS0_HUMAN L-serine ammonia-lyase (Fragment) OS=Homo sapiens OX=9606 GN=SDS PE=1 SV=1
7	A0A1D8PGA8	2.86e-42	151	353	0.301	0.280	A0A1D8PGA8_CANAL Cha1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHA1 PE=4 SV=1
8	Q59P56	2.27e-31	125	569	0.277	0.160	Q59P56_CANAL Threonine dehydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ILV1 PE=3 SV=1
9	Q9AXU4	4.40e-27	113	601	0.261	0.143	TD_NICAT Threonine dehydratase OS=Nicotiana attenuata OX=49451 GN=TD PE=1 SV=1
10	P04968	1.99e-26	111	514	0.277	0.177	ILVA_ECOLI L-threonine dehydratase biosynthetic IlvA OS=Escherichia coli (strain K12) OX=83333 GN=ilvA PE=1 SV=1
11	P00927	1.22e-25	109	576	0.261	0.149	THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ILV1 PE=1 SV=2
12	P25306	2.61e-25	108	595	0.225	0.124	TD2_SOLLC Threonine dehydratase 2 biosynthetic, chloroplastic OS=Solanum lycopersicum OX=4081 GN=TD2 PE=1 SV=1
13	O94634	1.68e-24	106	600	0.274	0.150	THDH_SCHPO Threonine dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1677.03c PE=3 SV=1
14	Q2PGG3	8.61e-23	99.0	331	0.243	0.242	SRR_ARATH Serine racemase OS=Arabidopsis thaliana OX=3702 GN=SR PE=1 SV=1
15	A0FKE6	1.38e-22	100	606	0.264	0.144	TD1_SOLLC Threonine dehydratase 1 biosynthetic, chloroplastic OS=Solanum lycopersicum OX=4081 GN=TD1 PE=1 SV=1
16	Q10725	8.73e-21	93.2	326	0.280	0.282	FSDH_RALPI Phenylserine dehydratase OS=Ralstonia pickettii OX=329 GN=psdht PE=1 SV=3
17	Q9GZT4	1.29e-20	92.8	340	0.292	0.282	SRR_HUMAN Serine racemase OS=Homo sapiens OX=9606 GN=SRR PE=1 SV=1
18	Q9ZSS6	3.76e-20	93.2	592	0.234	0.130	THD1_ARATH Threonine dehydratase biosynthetic, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OMR1 PE=1 SV=1
19	Q7XSN8	1.83e-19	89.7	339	0.277	0.268	SRR_ORYSJ Serine racemase OS=Oryza sativa subsp. japonica OX=39947 GN=SERR PE=1 SV=2
20	Q54HH2	3.43e-18	85.9	324	0.249	0.253	SRR_DICDI Probable serine racemase OS=Dictyostelium discoideum OX=44689 GN=srr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00781 DAGK_cat	7.4e+02	11.2	Diacylglycerol kinase catalytic domain
2	PF00291 PALP	1.5e-67	239.7	Pyridoxal-phosphate dependent enzyme
3	PF13458 Peripla_BP_6	30	15.8	Periplasmic binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385790

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318868	0.944	Serine hydroxymethyltransferase, cytosolic
2	9606.ENSP00000333667	0.940	Serine hydroxymethyltransferase, mitochondrial
3	9606.ENSP00000381231	0.927	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
4	9606.ENSP00000302620	0.925	Alanine-glyoxylate aminotransferase
5	9606.ENSP00000378854	0.924	Phosphoserine phosphatase
6	9606.ENSP00000205402	0.919	Dihydrolipoyl dehydrogenase, mitochondrial
7	9606.ENSP00000339435	0.919	Serine racemase
8	9606.ENSP00000269980	0.909	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
9	9606.ENSP00000359151	0.909	Dihydrolipoamide branched chain transacylase E2
10	9606.ENSP00000443459	0.907	Branched-chain-amino-acid aminotransferase, cytosolic
11	9606.ENSP00000318351	0.906	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
12	9606.ENSP00000359976	0.898	Cystathionine gamma-lyase
13	9606.ENSP00000322991	0.891	Branched-chain-amino-acid aminotransferase, mitochondrial
14	9606.ENSP00000260508	0.868	Kynurenine--oxoglutarate transaminase 3
15	9606.ENSP00000274353	0.855	Betaine--homocysteine S-methyltransferase 1
16	9606.ENSP00000355536	0.853	Methionine synthase
17	9606.ENSP00000255192	0.842	S-methylmethionine--homocysteine S-methyltransferase BHMT2
18	9606.ENSP00000399415	0.831	Kynurenine--oxoglutarate transaminase 1
19	9606.ENSP00000262554	0.821	Serine palmitoyltransferase 1
20	9606.ENSP00000216484	0.819	Serine palmitoyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016829	0.999	lyase activity
GO:0005515	0.999	protein binding
GO:0042802	0.994	identical protein binding
GO:0097159	0.932	organic cyclic compound binding
GO:0043168	0.929	anion binding
GO:1901363	0.928	heterocyclic compound binding
GO:0036094	0.916	small molecule binding
GO:0016841	0.885	ammonia-lyase activity
GO:0030170	0.696	pyridoxal phosphate binding
GO:0016740	0.679	transferase activity
GO:0046983	0.439	protein dimerization activity
GO:0003941	0.303	L-serine ammonia-lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044281	0.993	small molecule metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:1901605	0.976	alpha-amino acid metabolic process
GO:0009058	0.956	biosynthetic process
GO:1901576	0.943	organic substance biosynthetic process
GO:0044283	0.921	small molecule biosynthetic process
GO:0044282	0.896	small molecule catabolic process
GO:0044249	0.853	cellular biosynthetic process
GO:0016053	0.697	organic acid biosynthetic process
GO:0046394	0.676	carboxylic acid biosynthetic process
GO:0009069	0.546	serine family amino acid metabolic process
GO:0009063	0.491	amino acid catabolic process
GO:0006563	0.343	L-serine metabolic process
GO:0032787	0.340	monocarboxylic acid metabolic process
GO:1901606	0.320	alpha-amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.983	cytosol
GO:0043227	0.961	membrane-bounded organelle
GO:0043229	0.960	intracellular organelle
GO:0005739	0.954	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.-.-.-	0.999	Lyases.
EC:4.3.1.-	0.885	Ammonia-lyases.
EC:2.-.-.-	0.679	Transferases.
RHEA:19169	0.303	L-serine = NH4(+) + pyruvate
EC:4.3.1.17	0.303	L-serine ammonia-lyase.

[back to server]