StarFunc result for job id Q96GC6

User Input

>input (653 residues)
MASRLPTAWSCEPVTFEDVTLGFTPEEWGLLDLKQKSLYREVMLENYRNLVSVEHQLSKP
DVVSQLEEAEDFWPVERGIPQDTIPEYPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEV
AGPRNAQIQALYAEDGSLSADAPSEQVQQQGKHPGDPEAARQRFRQFRYKDMTGPREALD
QLRELCHQWLQPKARSKEQILELLVLEQFLGALPVKLRTWVESQHPENCQEVVALVEGVT
WMSEEEVLPAGQPAEGTTCCLEVTAQQEEKQEDAAICPVTVLPEEPVTFQDVAVDFSREE
WGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSDIPEEEPAPSLKVQESSRD
CALSSTLEDTLQGGVQEVQDTVLKQMESAQEKDLPQKKHFDNRESQANSGALDTNQVSLQ
KIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKE
GNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQDC
GKGFVQSSSLTQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQDCGKAF
RQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96GC6	1.000	1.000	1.901E-103	653	1.000	1.000	Q96GC6.pdb.gz	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
2	AFDB:Q923B3	0.216	0.171	6.933E-52	828	0.593	0.467	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
3	AFDB:Q921B4	0.219	0.175	5.226E-51	824	0.564	0.447	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
4	AFDB:P17029	0.217	0.250	1.534E-29	563	0.268	0.311	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
5	AFDB:Q9P0L1	0.219	0.190	3.982E-29	754	0.260	0.225	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
6	AFDB:P10073	0.214	0.282	2.267E-28	491	0.250	0.332	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
7	AFDB:Q53GI3	0.149	0.170	4.974E-28	561	0.285	0.332	Q53GI3.pdb.gz	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
8	AFDB:Q86W11	0.208	0.272	5.564E-28	494	0.260	0.344	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
9	AFDB:O14771	0.216	0.304	6.585E-28	459	0.257	0.366	O14771.pdb.gz	ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens OX=9606 GN=ZNF213 PE=1 SV=2
10	AFDB:P17022	0.210	0.248	7.366E-28	549	0.254	0.302	P17022.pdb.gz	ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens OX=9606 GN=ZNF18 PE=1 SV=2
11	PDB:3w5kB	0.077	0.256	1.045E-4	110	0.063	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6nmiC	0.068	0.101	1.816	408	0.044	0.071	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
13	PDB:6zheC	0.071	0.067	2.404	705	0.046	0.043	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
14	PDB:5xbtA	0.048	0.090	3.183	271	0.035	0.085	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
15	PDB:1oqyA	0.055	0.088	4.213	363	0.060	0.107	1oqyA.pdb.gz
16	PDB:7l08V	0.047	0.109	4.457	206	0.021	0.068	7l08V.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
17	PDB:7eghA	0.041	0.043	4.714	630	0.018	0.019	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:2rvqC	0.050	0.146	4.986	133	0.026	0.128	2rvqC.pdb.gz
19	PDB:3gn5A	0.030	0.115	4.986	132	0.011	0.053	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
20	PDB:7ajuUT	0.055	0.018	5.274	2313	0.021	0.006	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96GC6	0.0	1355	653	1.000	1.000	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
2	Q923B3	7.18e-145	443	828	0.351	0.277	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
3	Q921B4	5.90e-143	438	824	0.351	0.278	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
4	Q9EQB9	3.26e-97	317	759	0.306	0.264	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
5	Q15776	1.28e-92	300	578	0.312	0.353	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
6	Q8NF99	3.53e-88	286	534	0.288	0.352	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
7	P17029	1.12e-83	276	563	0.285	0.330	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
8	Q53GI3	3.98e-83	274	561	0.285	0.332	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
9	Q9P0L1	4.38e-82	276	754	0.283	0.245	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
10	Q9UJL9	1.30e-79	264	534	0.262	0.320	ZF69B_HUMAN Zinc finger protein 69 homolog B OS=Homo sapiens OX=9606 GN=ZFP69B PE=1 SV=2
11	P17036	2.71e-76	253	446	0.225	0.330	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
12	Q8BGV5	3.55e-76	256	572	0.240	0.274	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
13	Q86U76	5.87e-76	251	410	0.225	0.359	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
14	Q9BRR0	1.77e-74	251	538	0.270	0.327	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
15	P17098	6.11e-74	250	575	0.222	0.252	ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens OX=9606 GN=ZNF8 PE=1 SV=2
16	O95125	4.59e-73	249	648	0.306	0.309	ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens OX=9606 GN=ZNF202 PE=1 SV=4
17	Q8IZ26	5.29e-72	244	560	0.242	0.282	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
18	A0A0C4DG42	6.76e-72	244	539	0.237	0.288	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
19	A0A0S2Z658	7.10e-72	244	545	0.277	0.332	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
20	Q969J2	7.10e-72	244	545	0.277	0.332	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05191 ADK_lid	8e+02	11.4	Adenylate kinase, active site lid
2	PF00130 C1_1	7.3e+02	11.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF01352 KRAB	1e-43	158.0	KRAB box
4	PF02023 SCAN	2.3e-35	131.6	SCAN domain
5	PF01286 XPA_N	1.4	20.3	XPA protein N-terminal
6	PF00096 zf-C2H2	1.6e-25	99.2	Zinc finger, C2H2 type
7	PF13894 zf-C2H2_4	3.8e-13	60.0	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	76	14.7	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	0.58	21.8	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	2e-25	99.2	Zinc-finger double domain
11	PF12874 zf-met	95	14.8	Zinc-finger of C2H2 type
12	PF18439 zf_UBZ	23	16.1	Ubiquitin-Binding Zinc Finger
13	PF17032 zinc_ribbon_15	2.1e+02	14.1	zinc-ribbon family
14	PF09723 Zn-ribbon_8	1.6	20.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000172229	0.978	Tumor necrosis factor receptor superfamily member 16
2	9606.ENSP00000271640	0.949	Histone-lysine N-methyltransferase SETDB1
3	9606.ENSP00000433623	0.938	TNF receptor-associated factor 6
4	9606.ENSP00000256637	0.927	Sortilin
5	9606.ENSP00000358525	0.915	Beta-nerve growth factor
6	9606.ENSP00000269305	0.912	Cellular tumor antigen p53
7	9606.ENSP00000396843	0.911	Nuclear factor 1 C-type
8	9606.ENSP00000414303	0.910	Brain-derived neurotrophic factor
9	9606.ENSP00000326366	0.902	Presenilin-1
10	9606.ENSP00000352157	0.902	Mitogen-activated protein kinase 10
11	9606.ENSP00000378974	0.902	Mitogen-activated protein kinase 8
12	9606.ENSP00000394560	0.902	Mitogen-activated protein kinase 9
13	9606.ENSP00000401566	0.901	Protein ecdysoneless homolog
14	9606.ENSP00000261879	0.900	Gamma-secretase subunit APH-1B
15	9606.ENSP00000294785	0.900	Nicastrin
16	9606.ENSP00000299314	0.900	N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
17	9606.ENSP00000309968	0.900	Disintegrin and metalloproteinase domain-containing protein 17
18	9606.ENSP00000358105	0.900	Gamma-secretase subunit APH-1A
19	9606.ENSP00000468411	0.900	Gamma-secretase subunit PEN-2
20	9606.ENSP00000253024	0.885	Transcription intermediary factor 1-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0003682	0.927	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.998	regulation of macromolecule metabolic process
GO:0031323	0.997	regulation of cellular metabolic process
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0031326	0.987	regulation of cellular biosynthetic process
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0009987	0.961	cellular process
GO:0048519	0.953	negative regulation of biological process
GO:0048523	0.911	negative regulation of cellular process
GO:0009892	0.866	negative regulation of metabolic process
GO:0010605	0.855	negative regulation of macromolecule metabolic process
GO:0051172	0.853	negative regulation of nitrogen compound metabolic process
GO:0031324	0.850	negative regulation of cellular metabolic process
GO:1902679	0.841	negative regulation of RNA biosynthetic process
GO:0045892	0.833	negative regulation of DNA-templated transcription
GO:0071840	0.807	cellular component organization or biogenesis
GO:0000122	0.799	negative regulation of transcription by RNA polymerase II
GO:0016043	0.796	cellular component organization
GO:0048518	0.729	positive regulation of biological process
GO:0006325	0.689	chromatin organization
GO:0048522	0.523	positive regulation of cellular process
GO:0009893	0.511	positive regulation of metabolic process
GO:0010604	0.419	positive regulation of macromolecule metabolic process
GO:0006338	0.417	chromatin remodeling
GO:0051173	0.417	positive regulation of nitrogen compound metabolic process
GO:0031325	0.335	positive regulation of cellular metabolic process
GO:0071704	0.316	organic substance metabolic process
GO:0050896	0.301	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	1.000	nuclear lumen
GO:0005654	0.988	nucleoplasm
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0005737	0.923	cytoplasm
GO:0005730	0.863	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]