StarFunc result for job id Q96GF1

User Input

>input (192 residues)
MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCW
PCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENR
GGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLF
VALVIMFWLLIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96GF1	1.000	1.000	1.037E-33	192	1.000	1.000	Q96GF1.pdb.gz	RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens OX=9606 GN=RNF185 PE=1 SV=1
2	AFDB:Q8IR26	0.376	0.261	9.474E-19	283	0.516	0.350	Q8IR26.pdb.gz	Q8IR26_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd2 PE=2 SV=2
3	AFDB:A0A024RCQ4	0.385	0.361	4.412E-18	180	0.568	0.606	A0A024RCQ4.pdb.gz	A0A024RCQ4_HUMAN E3 ubiquitin-protein ligase RNF OS=Homo sapiens OX=9606 GN=RNF5 PE=4 SV=1
4	AFDB:Q09463	0.388	0.321	3.546E-15	235	0.469	0.383	Q09463.pdb.gz	RNF5_CAEEL E3 ubiquitin ligase rnf-5 OS=Caenorhabditis elegans OX=6239 GN=rnf-5 PE=1 SV=1
5	AFDB:O64824	0.369	0.317	7.065E-11	227	0.396	0.335	O64824.pdb.gz	O64824_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g23780 PE=1 SV=1
6	AFDB:Q8GUK7	0.320	0.256	1.927E-10	243	0.312	0.247	Q8GUK7.pdb.gz	RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana OX=3702 GN=RMA3 PE=1 SV=1
7	AFDB:O64425	0.347	0.273	6.868E-10	249	0.307	0.237	O64425.pdb.gz	RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana OX=3702 GN=RMA1 PE=1 SV=1
8	AFDB:Q6R567	0.350	0.272	1.140E-8	252	0.302	0.230	Q6R567.pdb.gz	RMA1_CAPAN E3 ubiquitin-protein ligase RMA1H1 OS=Capsicum annuum OX=4072 GN=RMA1H1 PE=1 SV=1
9	AFDB:A0A384L3Q5	0.330	0.153	8.481E-8	436	0.245	0.108	A0A384L3Q5.pdb.gz	A0A384L3Q5_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52590 PE=1 SV=1
10	AFDB:P93744	0.337	0.161	4.223E-7	425	0.276	0.125	P93744.pdb.gz	P93744_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE2 PE=1 SV=1
11	PDB:5dkaA	0.251	0.486	3.215E-4	96	0.094	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.270	0.206	7.671E-4	254	0.099	0.075	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:7jzvA	0.265	0.204	1.401E-3	253	0.094	0.071	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
14	PDB:5gm6a	0.244	0.370	2.392E-3	123	0.068	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:5a31B	0.239	0.526	5.337E-3	84	0.073	0.167	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:7oikA	0.227	0.012	6.523E-3	4426	0.104	0.005	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
17	PDB:5l9uB	0.232	0.602	8.524E-3	71	0.073	0.197	5l9uB.pdb.gz
18	PDB:3jb9U	0.238	0.114	1.556E-2	430	0.068	0.030	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:8a3tU	0.230	0.377	2.486E-2	114	0.089	0.149	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:5gmkq	0.247	0.129	2.658E-2	387	0.042	0.021	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96GF1	2.13e-140	390	192	1.000	1.000	RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens OX=9606 GN=RNF185 PE=1 SV=1
2	Q9VXP1	4.06e-70	216	277	0.562	0.390	Q9VXP1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd1 PE=1 SV=1
3	O35445	1.27e-67	206	180	0.526	0.561	RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus OX=10090 GN=Rnf5 PE=1 SV=1
4	A0A024RCQ4	3.71e-67	205	180	0.526	0.561	A0A024RCQ4_HUMAN E3 ubiquitin-protein ligase RNF OS=Homo sapiens OX=9606 GN=RNF5 PE=4 SV=1
5	Q99942	3.71e-67	205	180	0.526	0.561	RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens OX=9606 GN=RNF5 PE=1 SV=1
6	Q8IR26	2.16e-59	189	283	0.516	0.350	Q8IR26_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd2 PE=2 SV=2
7	Q09463	5.87e-45	150	235	0.474	0.387	RNF5_CAEEL E3 ubiquitin ligase rnf-5 OS=Caenorhabditis elegans OX=6239 GN=rnf-5 PE=1 SV=1
8	O64824	2.11e-30	112	227	0.260	0.220	O64824_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g23780 PE=1 SV=1
9	O64425	1.88e-25	100	249	0.255	0.197	RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana OX=3702 GN=RMA1 PE=1 SV=1
10	Q8GUK7	7.51e-22	90.9	243	0.240	0.189	RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana OX=3702 GN=RMA3 PE=1 SV=1
11	P93030	1.04e-21	89.4	193	0.323	0.321	RMA2_ARATH E3 ubiquitin-protein ligase RMA2 OS=Arabidopsis thaliana OX=3702 GN=RMA2 PE=1 SV=1
12	P93744	1.74e-21	92.8	425	0.214	0.096	P93744_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE2 PE=1 SV=1
13	A0A384L3Q5	4.60e-21	91.7	436	0.208	0.092	A0A384L3Q5_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52590 PE=1 SV=1
14	Q8RXF2	4.60e-21	91.7	436	0.208	0.092	Q8RXF2_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE1 PE=1 SV=1
15	Q6R567	1.61e-18	82.4	252	0.193	0.147	RMA1_CAPAN E3 ubiquitin-protein ligase RMA1H1 OS=Capsicum annuum OX=4072 GN=RMA1H1 PE=1 SV=1
16	Q6NLR3	1.24e-15	76.3	413	0.182	0.085	Q6NLR3_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g44410 PE=1 SV=1
17	Q582V4	2.82e-12	65.9	298	0.130	0.084	Q582V4_TRYB2 Peroxisome assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.510 PE=3 SV=1
18	O74563	6.69e-10	59.7	680	0.146	0.041	BRL2_SCHPO E3 ubiquitin-protein ligase brl2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brl2 PE=1 SV=1
19	Q9W0D7	1.15e-09	58.5	299	0.115	0.074	Q9W0D7_DROME GM14467p OS=Drosophila melanogaster OX=7227 GN=Pex10 PE=2 SV=1
20	Q95216	4.44e-09	57.4	1005	0.151	0.029	HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus OX=9986 GN=HLTF PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	2	19.8	Baculovirus immediate-early protein (IE-0)
2	PF14447 Prok-RING_4	0.0044	28.2	Prokaryotic RING finger family 4
3	PF04641 Rtf2	1.3e+02	13.4	Rtf2 RING-finger
4	PF12861 zf-ANAPC11	0.38	22.2	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	6.3e-07	40.5	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	6.1e-06	37.3	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	3.8e-07	41.1	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	1.1	20.7	zinc finger of C3HC4-type, RING
9	PF11789 zf-Nse	3.8e+02	12.4	Zinc-finger of the MIZ type in Nse subunit
10	PF12678 zf-rbx1	0.11	24.1	RING-H2 zinc finger domain
11	PF17120 zf-RING_16	6e+02	11.5	RING/Ubox like zinc-binding domain
12	PF13639 zf-RING_2	1.9e-06	39.4	Ring finger domain
13	PF14570 zf-RING_4	1.3e+02	13.7	RING/Ubox like zinc-binding domain
14	PF14634 zf-RING_5	0.00095	30.4	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	0.00038	31.8	RING-type zinc-finger
16	PF14569 zf-UDP	81	14.8	Zinc-binding RING-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008587868.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008563146.1	0.796	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008586407.1	0.794	E3 ubiquitin-protein ligase RNF5
3	482537.XP_008590275.1	0.794	E3 ubiquitin-protein ligase RNF5
4	482537.XP_008570830.1	0.782	Peroxisome assembly protein 12
5	482537.XP_008572516.1	0.777	Protein sel-1 homolog 1
6	482537.XP_008569725.1	0.742	Peroxisome biogenesis factor 2
7	482537.XP_008577814.1	0.740	Derlin-1
8	482537.XP_008571677.1	0.690	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 13 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
9	482537.XP_008579296.1	0.680	Cystic fibrosis transmembrane conductance regulator
10	482537.XP_008586169.1	0.679	Erlin-2 isoform X1
11	482537.XP_008568819.1	0.673	Erlin-1
12	482537.XP_008569595.1	0.671	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 3 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008580820.1	0.666	Endoplasmic reticulum lectin 1 isoform X1
14	482537.XP_008580633.1	0.657	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 23 mRNAs, 29 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
15	482537.XP_008583449.1	0.652	RING finger protein 175
16	482537.XP_008579823.1	0.638	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 9 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008566792.1	0.630	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 12 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
18	482537.XP_008590905.1	0.629	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 41% coverage of the annotated genomic feature by RNAseq alignments
19	482537.XP_008582923.1	0.625	Peroxisomal biogenesis factor 19
20	482537.XP_008582925.1	0.625	Peroxisomal biogenesis factor 19-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0044390	1.000	ubiquitin-like protein conjugating enzyme binding
GO:0043130	1.000	ubiquitin binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.982	cellular metabolic process
GO:0019538	0.982	protein metabolic process
GO:0044260	0.969	cellular macromolecule metabolic process
GO:0036211	0.968	protein modification process
GO:0050794	0.965	regulation of cellular process
GO:1901565	0.960	organonitrogen compound catabolic process
GO:0050896	0.958	response to stimulus
GO:0006511	0.951	ubiquitin-dependent protein catabolic process
GO:0016567	0.946	protein ubiquitination
GO:0030433	0.901	ubiquitin-dependent ERAD pathway
GO:0019222	0.892	regulation of metabolic process
GO:1903050	0.837	regulation of proteolysis involved in protein catabolic process
GO:0048518	0.800	positive regulation of biological process
GO:0048583	0.780	regulation of response to stimulus
GO:0009894	0.764	regulation of catabolic process
GO:1903052	0.764	positive regulation of proteolysis involved in protein catabolic process
GO:0051179	0.717	localization
GO:0023051	0.712	regulation of signaling
GO:0010646	0.712	regulation of cell communication
GO:0080134	0.704	regulation of response to stress
GO:0006517	0.702	protein deglycosylation
GO:0048522	0.697	positive regulation of cellular process
GO:0080135	0.654	regulation of cellular response to stress
GO:0060759	0.641	regulation of response to cytokine stimulus
GO:0009896	0.641	positive regulation of catabolic process
GO:0009966	0.627	regulation of signal transduction
GO:0048584	0.625	positive regulation of response to stimulus
GO:0001959	0.605	regulation of cytokine-mediated signaling pathway
GO:1905897	0.600	regulation of response to endoplasmic reticulum stress
GO:0060760	0.594	positive regulation of response to cytokine stimulus
GO:0060338	0.590	regulation of type I interferon-mediated signaling pathway
GO:1905898	0.576	positive regulation of response to endoplasmic reticulum stress
GO:0002833	0.532	positive regulation of response to biotic stimulus
GO:0051234	0.518	establishment of localization
GO:0006810	0.489	transport
GO:0031349	0.452	positive regulation of defense response
GO:0032103	0.433	positive regulation of response to external stimulus
GO:0000209	0.423	protein polyubiquitination
GO:0031323	0.381	regulation of cellular metabolic process
GO:0050778	0.376	positive regulation of immune response
GO:0140546	0.374	defense response to symbiont
GO:0045089	0.365	positive regulation of innate immune response
GO:0023056	0.358	positive regulation of signaling
GO:0010647	0.358	positive regulation of cell communication
GO:0048519	0.343	negative regulation of biological process
GO:0042176	0.342	regulation of protein catabolic process
GO:0009967	0.334	positive regulation of signal transduction
GO:0009615	0.332	response to virus
GO:0061136	0.316	regulation of proteasomal protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.999	membrane
GO:0031090	0.987	organelle membrane
GO:0042175	0.977	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.971	endoplasmic reticulum membrane
GO:0005829	0.500	cytosol
GO:0005634	0.404	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]