StarFunc result for job id Q96GI7

User Input

>input (184 residues)
MSGARAAPGAAGNGAVRGLRVDGLPPLPKSLSGLLHSASGGGASGGWRHLERLYAQKSRI
QDELSRGGPGGGGARAAALPAKPPNLDAALALLRKEMVGLRQLDMSLLCQLYSLYESIQE
YKGACQAASSPDCTYALENGFFDEEEEYFQEQNSLHDRRDRGPPRDLSLPVSSLSSSDWI
LESI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q566R4	0.359	0.351	3.017E-8	189	0.424	0.413	Q566R4.pdb.gz	LRA25_RAT Leucine repeat adapter protein 25 OS=Rattus norvegicus OX=10116 GN=Fam89b PE=1 SV=1
2	AFDB:P31368	0.190	0.069	4.375E-1	601	0.152	0.047	P31368.pdb.gz	PDM1_DROME Protein nubbin OS=Drosophila melanogaster OX=7227 GN=nub PE=2 SV=1
3	AFDB:Q9NQ50	0.240	0.215	5.367E-1	206	0.152	0.136	Q9NQ50.pdb.gz	RM40_HUMAN Large ribosomal subunit protein mL40 OS=Homo sapiens OX=9606 GN=MRPL40 PE=1 SV=1
4	AFDB:C0H5L9	0.275	0.213	9.257E-1	249	0.147	0.108	C0H5L9.pdb.gz	C0H5L9_PLAF7 Membrane associated histidine-rich protein 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1370300 PE=4 SV=1
5	AFDB:B7Z058	0.144	0.047	1.061	906	0.179	0.036	B7Z058.pdb.gz	B7Z058_DROME Rho GTPase activating protein at 71E, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=1
6	AFDB:Q94CL7	0.268	0.139	1.136	409	0.152	0.068	Q94CL7.pdb.gz	PHR1_ARATH Protein PHOSPHATE STARVATION RESPONSE 1 OS=Arabidopsis thaliana OX=3702 GN=PHR1 PE=1 SV=1
7	AFDB:Q9Y6I3	0.244	0.086	1.136	576	0.141	0.045	Q9Y6I3.pdb.gz	EPN1_HUMAN Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2
8	AFDB:P53947	0.227	0.146	1.216	316	0.152	0.089	P53947.pdb.gz	YNF8_YEAST Vacuolar membrane protein YNL058C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL058C PE=1 SV=1
9	AFDB:Q28362	0.170	0.052	1.216	839	0.125	0.027	Q28362.pdb.gz	SL9A3_DIDVI Sodium/hydrogen exchanger 3 OS=Didelphis virginiana OX=9267 GN=SLC9A3 PE=1 SV=1
10	PDB:6yxyBJ	0.125	0.091	1.755	293	0.092	0.058	6yxyBJ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
11	AFDB:P26433	0.169	0.044	1.959	831	0.136	0.030	P26433.pdb.gz	SL9A3_RAT Sodium/hydrogen exchanger 3 OS=Rattus norvegicus OX=10116 GN=Slc9a3 PE=1 SV=2
12	PDB:7enaq	0.230	0.102	4.257	555	0.158	0.052	7enaq.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:7v2wJ	0.157	0.128	4.257	236	0.120	0.093	7v2wJ.pdb.gz
14	PDB:1xq8A	0.278	0.335	5.591	140	0.109	0.143	1xq8A.pdb.gz
15	PDB:7clvA	0.121	0.105	5.985	222	0.141	0.117	7clvA.pdb.gz	Solution structure of the voltage-gated Tim23 channel in complex with a mitochondrial presequence peptide.
16	PDB:3j6b2	0.198	0.289	6.858	113	0.098	0.159	3j6b2.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:7enah	0.143	0.139	8.414	190	0.087	0.084	7enah.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:5u0pQ	0.208	0.099	9.642	508	0.114	0.041	5u0pQ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QUI1	9.20e-36	125	189	0.424	0.413	LRA25_MOUSE Leucine repeat adapter protein 25 OS=Mus musculus OX=10090 GN=Fam89b PE=1 SV=1
2	Q566R4	1.92e-35	124	189	0.413	0.402	LRA25_RAT Leucine repeat adapter protein 25 OS=Rattus norvegicus OX=10116 GN=Fam89b PE=1 SV=1
3	Q8IV03	0.018	37.0	228	0.114	0.092	LUR1L_HUMAN Leucine rich adaptor protein 1-like OS=Homo sapiens OX=9606 GN=LURAP1L PE=1 SV=3
4	Q8IHF4	0.58	33.1	729	0.147	0.037	Q8IHF4_DROME AT07729p OS=Drosophila melanogaster OX=7227 GN=Klp59D PE=2 SV=1
5	Q9W1U1	0.82	32.7	729	0.147	0.037	Q9W1U1_DROME FI21273p1 OS=Drosophila melanogaster OX=7227 GN=Klp59D PE=2 SV=2
6	Q5BU19	1.3	32.0	1147	0.098	0.016	Q5BU19_DANRE C-terminal-binding protein 2 isoform 1 OS=Danio rerio OX=7955 GN=wu:fb96g03 PE=1 SV=1
7	Q7K4M9	2.1	31.2	637	0.082	0.024	Q7K4M9_DROME LD31969p OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
8	P59833	2.2	30.8	196	0.120	0.112	UGPI3_ARATH Uncharacterized GPI-anchored protein At5g19250 OS=Arabidopsis thaliana OX=3702 GN=At5g19250 PE=2 SV=1
9	Q8IGB6	2.2	31.2	618	0.082	0.024	Q8IGB6_DROME RH65876p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG15118 PE=2 SV=1
10	Q8JJ48	2.3	31.2	818	0.130	0.029	DCT1A_XENLA Dapper 1-A OS=Xenopus laevis OX=8355 GN=dact1-a PE=1 SV=1
11	Q02928	4.8	30.0	519	0.087	0.031	CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens OX=9606 GN=CYP4A11 PE=1 SV=1
12	A1ZBH1	4.9	30.0	592	0.082	0.025	A1ZBH1_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
13	Q9H2W6	4.9	30.0	279	0.136	0.090	RM46_HUMAN Large ribosomal subunit protein mL46 OS=Homo sapiens OX=9606 GN=MRPL46 PE=1 SV=1
14	A1L168	5.2	28.9	122	0.109	0.164	CT202_HUMAN Uncharacterized protein C20orf202 OS=Homo sapiens OX=9606 GN=C20orf202 PE=1 SV=3
15	O96166	5.3	30.0	1105	0.065	0.011	O96166_PLAF7 Serine repeat antigen 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0207900 PE=3 SV=3
16	A8DYI9	5.4	30.0	630	0.082	0.024	A8DYI9_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=anon-EST:fe1H12 PE=1 SV=1
17	C2M262	7.7	29.6	715	0.103	0.027	DPP7_CAPGI Dipeptidyl-peptidase 7 OS=Capnocytophaga gingivalis OX=553178 GN=dpp7 PE=1 SV=1
18	Q8VC66	8.8	29.3	615	0.120	0.036	ADIP_MOUSE Afadin- and alpha-actinin-binding protein OS=Mus musculus OX=10090 GN=Ssx2ip PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14854 LURAP	0.44	21.9	Leucine rich adaptor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355614

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356058	0.711	Fas apoptotic inhibitory molecule 3
2	9606.ENSP00000359787	0.559	Interferon-induced protein 44-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048583	0.960	regulation of response to stimulus
GO:0023051	0.944	regulation of signaling
GO:0010646	0.944	regulation of cell communication
GO:0009987	0.941	cellular process
GO:0009966	0.901	regulation of signal transduction
GO:0048523	0.589	negative regulation of cellular process
GO:0048518	0.482	positive regulation of biological process
GO:1902531	0.457	regulation of intracellular signal transduction
GO:0090287	0.456	regulation of cellular response to growth factor stimulus
GO:2000147	0.425	positive regulation of cell motility
GO:0030334	0.423	regulation of cell migration
GO:0030335	0.409	positive regulation of cell migration
GO:0090092	0.408	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009968	0.356	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0120025	0.828	plasma membrane bounded cell projection
GO:0031252	0.766	cell leading edge
GO:0030027	0.701	lamellipodium
GO:0043229	0.616	intracellular organelle
GO:0043231	0.567	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]