StarFunc result for job id Q96GM5

User Input

>input (515 residues)
MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPR
PGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN
HNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKR
KLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSL
VIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPR
LARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQR
LHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATL
DNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAE
FYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZBS9	0.830	0.830	3.734E-88	515	0.998	0.998	D3ZBS9.pdb.gz	D3ZBS9_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=2
2	AFDB:Q802C8	0.773	0.780	4.165E-81	510	0.889	0.898	Q802C8.pdb.gz	Q802C8_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Danio rerio OX=7955 GN=wu:fa10h07 PE=1 SV=1
3	AFDB:B2KL77	0.738	0.796	2.208E-70	476	0.717	0.775	B2KL77.pdb.gz	B2KL77_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Danio rerio OX=7955 GN=smarcd3b PE=1 SV=1
4	AFDB:F6NVB1	0.704	0.710	3.237E-67	510	0.674	0.680	F6NVB1.pdb.gz
5	AFDB:E7EYW7	0.698	0.717	1.158E-64	501	0.633	0.651	E7EYW7.pdb.gz	E7EYW7_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 isoform X1 OS=Danio rerio OX=7955 GN=smarcd2 PE=3 SV=1
6	AFDB:Q6P9Z1	0.684	0.727	1.302E-64	483	0.664	0.708	Q6P9Z1.pdb.gz	SMRD3_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Mus musculus OX=10090 GN=Smarcd3 PE=1 SV=2
7	AFDB:Q09646	0.722	0.827	1.331E-54	446	0.462	0.534	Q09646.pdb.gz	SWIC1_CAEEL SWI/SNF chromatin-remodeling accessory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ham-3 PE=1 SV=1
8	AFDB:O02101	0.696	0.791	4.487E-52	449	0.449	0.514	O02101.pdb.gz	SWIC2_CAEEL SWI/SNF chromatin-remodeling accessory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=swsn-2.2 PE=1 SV=2
9	AFDB:Q9FMT4	0.614	0.594	6.093E-41	534	0.309	0.298	Q9FMT4.pdb.gz	SNF12_ARATH SWI/SNF complex component SNF12 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g14170 PE=1 SV=1
10	AFDB:Q9P7S3	0.610	0.722	2.980E-40	425	0.256	0.311	Q9P7S3.pdb.gz	SSR3_SCHPO SWI/SNF and RSC complexes subunit ssr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssr3 PE=1 SV=1
11	PDB:7vdvY	0.378	0.746	7.977E-28	245	0.474	0.996	7vdvY.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
12	PDB:7egmH	0.397	0.495	4.394E-21	388	0.184	0.245	7egmH.pdb.gz
13	PDB:6v8oM	0.229	0.350	1.346E-8	310	0.085	0.142	6v8oM.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
14	PDB:6k15I	0.224	0.422	7.779E-7	244	0.072	0.152	6k15I.pdb.gz	Structure of the RSC complex bound to the nucleosome.
15	PDB:6uxvH	0.269	0.477	5.414E-6	257	0.082	0.163	6uxvH.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
16	PDB:5svan	0.170	0.362	2.332E-4	200	0.045	0.115	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:6tdaO	0.197	0.425	3.732E-4	212	0.062	0.151	6tdaO.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
18	PDB:5nzuD	0.091	0.106	1.705E-2	427	0.037	0.044	5nzuD.pdb.gz
19	PDB:5xbtA	0.078	0.135	2.426E-2	271	0.050	0.096	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
20	PDB:6xt9A	0.105	0.097	4.632E-2	567	0.052	0.048	6xt9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N8Z9	0.0	712	470	0.676	0.740	A0A090N8Z9_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Homo sapiens OX=9606 GN=SMARCD3 PE=3 SV=1
2	A0A8I5ZQQ2	0.0	709	483	0.668	0.712	A0A8I5ZQQ2_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
3	A0A8I6A286	0.0	707	461	0.668	0.746	A0A8I6A286_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
4	A0A8I6AJE1	0.0	866	474	0.918	0.998	A0A8I6AJE1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=1
5	B2KL77	0.0	716	476	0.703	0.761	B2KL77_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Danio rerio OX=7955 GN=smarcd3b PE=1 SV=1
6	B9EGA3	0.0	650	494	0.645	0.672	B9EGA3_HUMAN SMARCD2 protein OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=1
7	D3ZBS9	0.0	1035	520	0.967	0.958	D3ZBS9_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=2
8	E7EYW7	0.0	644	501	0.652	0.671	E7EYW7_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 isoform X1 OS=Danio rerio OX=7955 GN=smarcd2 PE=3 SV=1
9	J3KMX2	0.0	629	456	0.612	0.691	J3KMX2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=1
10	Q5U3Y2	0.0	710	470	0.674	0.738	Q5U3Y2_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
11	Q61466	0.0	1065	515	0.994	0.994	SMRD1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Mus musculus OX=10090 GN=Smarcd1 PE=1 SV=3
12	Q6P9Z1	0.0	711	483	0.670	0.714	SMRD3_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Mus musculus OX=10090 GN=Smarcd3 PE=1 SV=2
13	Q6STE5	0.0	711	483	0.670	0.714	SMRD3_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Homo sapiens OX=9606 GN=SMARCD3 PE=1 SV=1
14	Q802C8	0.0	877	510	0.880	0.888	Q802C8_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Danio rerio OX=7955 GN=wu:fa10h07 PE=1 SV=1
15	Q92925	0.0	641	531	0.623	0.605	SMRD2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3
16	Q96GM5	0.0	1069	515	1.000	1.000	SMRD1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2
17	Q9VYG2	0.0	629	515	0.594	0.594	BAP60_DROME Brahma-associated protein of 60 kDa OS=Drosophila melanogaster OX=7227 GN=Bap60 PE=1 SV=1
18	Q09646	4.86e-159	461	446	0.462	0.534	SWIC1_CAEEL SWI/SNF chromatin-remodeling accessory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ham-3 PE=1 SV=1
19	F8VZ70	1.32e-156	448	278	0.540	1.000	F8VZ70_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=1
20	O02101	6.81e-144	423	449	0.417	0.479	SWIC2_CAEEL SWI/SNF chromatin-remodeling accessory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=swsn-2.2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07980 SusD_RagB	9.2e+02	10.9	SusD family
2	PF02201 SWIB	3.2e-21	86.3	SWIB/MDM2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007452348.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007451083.1	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 isoform X1
2	118797.XP_007459363.1	0.999	AT-rich interactive domain-containing protein 1A
3	118797.XP_007460821.1	0.999	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
4	118797.XP_007465265.1	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 isoform X1
5	118797.XP_007466756.1	0.999	Belongs to the actin family.
6	118797.XP_007451418.1	0.998	AT-rich interactive domain-containing protein 1B
7	118797.XP_007454800.1	0.997	Double PHD fingers 3
8	118797.XP_007463893.1	0.997	AT-rich interactive domain-containing protein 2
9	118797.XP_007466817.1	0.997	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
10	118797.XP_007456829.1	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
11	118797.XP_007468907.1	0.996	Belongs to the actin family.
12	118797.XP_007471120.1	0.996	Double PHD fingers 1
13	118797.XP_007451928.1	0.994	Polybromo 1
14	118797.XP_007469874.1	0.994	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
15	118797.XP_007445984.1	0.993	PHD finger protein 10 isoform X1
16	118797.XP_007446202.1	0.990	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1
17	118797.XP_007467795.1	0.990	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2
18	118797.XP_007459538.1	0.987	Bromodomain-containing protein 7 isoform X1
19	118797.XP_007458451.1	0.982	SS18, nBAF chromatin remodeling complex subunit
20	118797.XP_007462070.1	0.981	Double PHD fingers 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.985	chromatin binding
GO:0005102	0.552	signaling receptor binding
GO:0140110	0.400	transcription regulator activity
GO:0003677	0.348	DNA binding
GO:0008134	0.326	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.970	regulation of biological process
GO:0006338	0.960	chromatin remodeling
GO:0050794	0.904	regulation of cellular process
GO:0034728	0.897	nucleosome organization
GO:0019222	0.875	regulation of metabolic process
GO:0010604	0.866	positive regulation of macromolecule metabolic process
GO:0050896	0.851	response to stimulus
GO:0031323	0.830	regulation of cellular metabolic process
GO:0080090	0.826	regulation of primary metabolic process
GO:0051171	0.826	regulation of nitrogen compound metabolic process
GO:0019219	0.824	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.820	regulation of gene expression
GO:0031326	0.787	regulation of cellular biosynthetic process
GO:0006355	0.784	regulation of DNA-templated transcription
GO:0048522	0.772	positive regulation of cellular process
GO:0051173	0.618	positive regulation of nitrogen compound metabolic process
GO:0051716	0.617	cellular response to stimulus
GO:0031325	0.611	positive regulation of cellular metabolic process
GO:0006357	0.581	regulation of transcription by RNA polymerase II
GO:0045935	0.579	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.539	positive regulation of macromolecule biosynthetic process
GO:0031328	0.526	positive regulation of cellular biosynthetic process
GO:1902680	0.520	positive regulation of RNA biosynthetic process
GO:0045893	0.487	positive regulation of DNA-templated transcription
GO:0032501	0.362	multicellular organismal process
GO:0048519	0.357	negative regulation of biological process
GO:0048523	0.322	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.989	nuclear lumen
GO:0032991	0.987	protein-containing complex
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0005654	0.972	nucleoplasm
GO:0000785	0.932	chromatin
GO:0140513	0.921	nuclear protein-containing complex
GO:1902494	0.920	catalytic complex
GO:1904949	0.697	ATPase complex
GO:0070603	0.687	SWI/SNF superfamily-type complex
GO:0016514	0.406	SWI/SNF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]